BLENDER_v248REND ,TexDemoGLOB  1x0t SRx@oxSR1-Animation`wno`oopȂx0t DATA`wnwnDATAwno`wn DATAoHown DATAHoooDATAooHoDATAo ooDATA ohooDATAhoo oDATAoohoDATAo@ooDATA@oooDATAoo@oDATAoooDATAooDATA`oownoDATAoo`o`wnHoDATAo8oownoDATA8oooo oDATAoo8oo oDATAoooohoDATAoXoo ooDATAXooohooDATAooXoo oDATAo0oo`wnoDATA0oxooo@oDATAxoo0oHo@oDATAooxoo@oDATAoPoohooDATAPoooooDATAooPoooDATAo(ooooDATA(opooooDATApoo(o@ooDATAoopoooDATAoHooooDATAHoooooDATAoHoooDATApp`wno@oHoOppxlyYxDATAxlymyLink and MaterialsEditing>DATAmynyxlyMeshEditingF>DATAnyoymyAnim settingsObject>DATAoyPxnyDrawObjectF>DATAPxRxoyConstraintsObject>DATARx SxPxEffectsObjectDATA Sx8TxRxHooksObjectF>oyDATA8TxPUx SxParticle InteractionObject>PxDATAPUxhVx8TxSoftbodyObject>PxDATAhVxWxPUxOutputRender>DATAWxXxhVxRenderRenderF>DATAXxYxWxAnimRender>DATAYxXxFormatRender>DATApp333?@DhCDhCC(BDC?z?DATApp333?/9DATApppowno o !  DATAp@ ppooohoG==o?ppxZx[xDATAZx[xTransform PropertiesView3d>DATA[xZx3D Viewport propertiesView3d>"DATAppx333?????????G==o? A*A?G==o??????*Az B??=C ݢM@ݢM@ݢM@? DATApxp333?/9DATA@ p}xphoo oo??PףHrx{x\x\xDATA\xTransform PropertiesIpo!>DATAXrxp333? zC̽̌?zC@ #< #<`jFzD zOBzC̽̌?DATApXtxrx333? CC|||??l|DATAXtx8uxp 333? zCCHBC|||?CFC= ADATA8uxuxXtx 333? Yt =rttDATAuxvx8ux 333? ?zDzDBCl||ll|zDzD=HB DATAvxwxux 333? BzB@l|llFzD #<HB DATAwx{xvx333? ??? ???? A???PA A!O?j?}GCHB? Az B? #<C DATA{xwx333? /9DATA}xȂx@ pooo@o ~xЀx^x(_xDATA^x(_xLink and MaterialsEditing>DATA(_x^xMeshEditingF>DATA~x~x333?J zCB{ µCB ?BFB= ADATA~xx~x 333?J zCCHBC$?CFC= ADATAxЀx~x333?J #DhC`DpJgChCC(BDC?z?DATAЀxx333?J /9DATAȂx}xoooo} ?=o?.Яpx@`xXaxDATA@`xXaxTransform PropertiesView3d>DATAXax@`x3D Viewport propertiesView3d>"DATAЯppx333? KDATAcxdxpbxLampLampF>DATAdxexcxSpotLamp>DATAexfxdxTexture and InputLamp>DATAfxgxexMap ToLamp>exDATAgxixfxPreviewMaterial>IDATAixjxgxMaterialMaterial>IDATAjx0kxixPreviewWorld>DATA0kxHlxjxWorldWorldF>DATAHlx`mx0kxMist Stars PhysicsWorld>DATA`mxxnxHlxTexture and InputWorld>DATAxnxox`mxMap ToWorld>`mxDATAoxxxxnxOutputRender>DATAxxxoxRenderRenderF>DATAxxxxAnimRender>DATAxxxFormatRender>DATAx؏xxLink and MaterialsEditing>TDATA؏xxxMeshEditingF>TDATAxx؏xMesh ToolsEditing>SDATAx xxMesh Tools 1Editing>DATA x8xxCameraEditingF>DATA8xPx xShadersMaterial>IDATAPxhx8xTextureMaterial>IDATAhxxPxAnim settingsObject>DATAxxhxDrawObjectF>DATAxxxConstraintsObject>DATAxȚxxScriptlinksScript>DATAȚxxxEffectsObjectxDATAxxȚxMap InputMaterial>?PxDATAxxxMap ToMaterial>?PxDATAx(xxAnimAnim>DATA(x@xxSoundSound>DATA@xXx(xListenerSoundF>DATAXxpx@xSequencerSound>DATApxxXxArmatureEditingF>DATAxxpxRampsMaterial>IixDATAxxxMirror TranspMaterial>I8xDATAxЦxxMist / Stars / PhysicsWorld>DATAЦxxxAmb OccWorld>xDATAxxЦxShadow and SpotLamp>DATAxxxModifiersEditing>TDATAxxxxShapesEditing>TxDATAxxtxMultiresEditing>TDATAtptxxLinks and PipelineMaterialF>IDATApt ttSSSMaterial>I8xDATA ttptPreviewTexture>.DATAt!t tTextureTextureF>.DATA!t"ttColorsTextureF>-tDATA"t$t!tImageTexture>-DATA$t`(t"tMap ImageTexture>-DATA`(t*t$tMesh Tools MoreEditing^>SDATA*tx)t`(tUV CalculationEditing>SxxDATAx)t*tTexture FaceEditing>SxxDATA`x(s333?`xH9WDhC'BcDXiCC(BDC?z?0s[mDATA(sp`x333?`x??? ???? A??@PA Aj?c3>}GCHB? Az B? #<C DATAppx(s333?`xHE}CHE}C HE}C??DATApxp333?`x/9DATAx s s`xo ohoo<U<VUU:w:wDATA ssx sYPYo@oN?q?AHM:: OPp`Ps=w=wxxDATAxxTransform PropertiesView3d,>DATAxxView PropertiesView3dT>"DATAPpxJs333? sD;DQUUծ??O(:tdo?DATAxJsMsPp333? sݕ/?V~'?3F:?>T8175e?4>Z& 4?ߕ/?7F:?81X~>75e?'?T3>ne@>N@?8=8? {''ktC?:>?T?9~X? l4n+11A 4AV'?f1?( `>r?d4xB֟&BĭeA(@N?q?AHMݕ/?V~'?3F:?>T8175e?4>Z& 4?H?N+Z#{IA 4Az B??j;=C7?X<s(A@(A@(A@*??? ?DATAXMs`pxJs333? szC̽̌?zC@22 #< #<`jFzD zOBzC̽̌?DATA`phxMs333? sHEVDHEVD2 XHEVD??2DATAhxPOs`p 333? s?zDzB@22FzD #<HB DATAPOs`Pshx333? sDdC8CnD fCC(BDC?z?DATA`PsPOs333? sSELECT IMAGE PICTURESh:\Photos\Lanz's\display pics\9\222\final project\Resources/steampunk.jpg lWp̼pDATAs sooPYY5?|@AHM:: O#s@s(.w(.w0&tH'tDATA0&tH'tTransform PropertiesView3d,>DATAH't0&tView PropertiesView3dT>"DATAsw333?sݕ/?V~'?3F:?>T8175e?4>Z& 4?ߕ/?7F:?81X~>75e?'?T3>ne@>N@?=?_H''⫕?EE??T?ey @ l4? Hn11A 4A>>ܻ3 >ޫ>x·BF֟'BeA(@5?|@AHMݕ/?V~'?3F:?>T8175e?4>Z& 4?H?N+Z#{IA 4Az B??:=C7?X<???*??? ?DATAXwps333?szC̽̌?zC@22 #< #<`jFzD zOBzC̽̌?DATAp6]w333?sHEVDHEVD2 XHEVD??2wwDATA,wwBOq= zDATA,wpwwEM@|A btDATA,pwwwAM1~Ab>A^tDATA,w0wpwBO`AzDATA,0wwwBOp=AzDATA,w0wCS@ff0tDATA6]%tp 333?s?zDzB@22FzD #<HB DATA%t@s6]333?sDdC8CnD fCC(BDC?z?DATA@s%t333?s9Save AsMAGE PICTURESC:\Users\Lanz\Desktop\pring 2009\222\final project\Resources/basicTextureDemontitled.blend ЧASRxXRs`sxSR3-Materialodel SingpUs0Vs`\s ss0t DATAp0pDATA0pxpp DATAxpSs0p DATASs`SsxpDATA`SsSsSs<DATASsSs`Ss<DATASs8TsSsDATA8TsTsSsDATATsTs8Ts,<DATATsUsTs,DATAUsXUsTsDATAXUsUsUs,DATAUsUsXUsDATAUsUsDATA0VsxVs0pxpDATAxVsVs0VspSsDATAVsWsxVsp`SsDATAWsPWsVsSsSsDATAPWsWsWs`SsSsDATAWsWsPWs0pSsDATAWs(XsWsxp8TsDATA(XspXsWsSs8TsDATApXsXs(XsSs8TsDATAXsYspXs`SsTsDATAYsHYsXsSsTsDATAHYsYsYs8TsTsDATAYsYsHYsTsTsDATAYs ZsYs`SsUsDATA ZshZsYsSsUsDATAhZsZs ZsTsXUsDATAZsZshZsTsXUsDATAZs@[sZsUsXUsDATA@[s[sZsUsUsDATA[s[s@[sXUsUsDATA[s\s[sSsUsDATA\s`\s[sTsUsDATA`\s\sUsUsDATA s sp`SsSsSs?@Pף;;!csisxxDATAxدxOutputRender>DATAدxxxRenderRenderF>DATAxxدxAnimRender>DATAxxFormatRender>DATAcscs333? ~CA~CA!?AFA= ADATAcsdscs 333? zCCHBC ?CFC= ADATAdsescs333? DhC?DhCC(BDC?z?mDATAespds333? ??? ???? A??@PA Aj?c3>}GCHB? Az B? #<C DATApises333? @̌AR|B1@lA A@CC #<@DATAisp333? /9DATA s s sSs0pxp8Ts !  DATA ss sTsTs8TsSsG@? JL-=-=W-X~ksps x(xDATA x8xOutputRender>DATA8xPx xRenderRender>DATAPxhx8xAnimRender0>DATAhxxPxFormatRenderH>DATAxxhxPreviewMaterial>DATAxxxMaterialMaterial>DATAxȺxxShadersMaterial0>DATAȺxxxTextureMaterialD>DATAxxȺxMap InputMaterial\>DATAxxxMap ToMaterial`>DATAx(xxRampsMaterial>xDATA(xxMirror TranspMaterialH>DATAks ls333?*ChCCvgCC(BDC?z?DATA lsposks333?*J>H!?)xu?i6>Pbܗ=(?^L?a?滎z?J>#xu?ܗ=Hi6>(? ?Pb^L?\FAA?4[?[!?@jG>gb>Pb>4Im>k&?]M^L<0@AzA=>Kc<2֍7&> ?:x¸A1vB,jB~@G@? JLJ>H!?)xu?i6>Pbܗ=(?^L?a?滎z?@?$$OAz B?=Ch?j(4?t'>d DATAXposps ls333?*zC AzC A #< #<`jFzD OBDATApspos333?*;SAVE FILE/usr/home/intrr/blender/blend/untitled.blendDATAss s`SsUsXUsTsU.=w=o?+=+=W+X,XrswsDATArs@x333????h?j(4?t'>????hj(4t'?U.=w=o??OAz B??=Ch?j(4?t'>dEh@Eh@Eh@? DATA@x@vsrs333?DdC>9C,DeCC(BDC?z?DATAX@vsws@x333?zC AzC A #< #<`jFzD OBDATAws@vs333? SAVE FILE/Users/ton/Desktop/der/blend/untitled.blendDATAsssUsUsTsXUse?B$?AHM+++USys~sDATAysXx333?ݕ/?U~'?3F:?>T8165e?2>Z& 4?ߕ/?7F:?81W~>85e?'?T2>ne@>M@?4z?'''䷄?K??T?v|@?l211A 4Atp>?@@FC>G ?4xB֟&BĭeA(@e?B$?AHMݕ/?U~'?3F:?>T8165e?2>Z& 4?H?N,Z#OAz B??=Ch?j(4?t'>dA@A@A@? DATAXx}sys333?DdC>9C,DeCC(BDC?z?DATAX}s~sXx333?zC AzC A #< #<`jFzD OBDATA~s}s333? SAVE FILE/Users/ton/Desktop/der/blend/untitled.blendDATAssUsSsUsUs&=+=o?USshsDATAspx333?*?3?3:-vk(4??3?3;@k(40v@?&=PU1n;+=ꉖø;ZO{:?JXA54U0AC;@j(40v@?&=+=o??3?3:-vk(4?5?5IXAz B??=C:j(4?.vdٚ@ٚ@ٚ@? DATApxss333?*DdC>9C,DeCC(BDC?z?DATAXshspx333?*zC AzC A #< #<`jFzD OBDATAhss333?* SAVE FILE/Users/ton/Desktop/der/blend/untitled.blendSRx`s0 tXRsSR4-Sequence\sP`s`ssss0t DATA\s\sDATA\s8]s\s DATA8]s]s\s DATA]s]s8]sDATA]s^s]sDATA^sX^s]sDATAX^s^s^sDATA^s^sX^sDATA^s0_s^sDATA0_sx_s^sDATAx_s_s0_sTDATA_s`sx_sTDATA`sP`s_sDATAP`s`sDATA`s`s\s8]sDATA`s(as`s\s]sDATA(aspas`s\s]sDATApasas(as]s^sDATAasbspas]s^sDATAbsHbsas\sX^sDATAHbsbsbs8]s^sDATAbs sHbsX^s^sDATA shsbsX^s^sDATAhss s^s0_sDATAsshs^s0_sDATAs@ss^sx_sDATA@sss0_sx_sDATAsЉs@sX^s_sDATAЉsss^s_sDATAs`sЉsx_s_sDATA`sss]s`sDATAss`s^s`sDATAs8ss0_sP`sDATA8sss^sP`sDATAs8s`sP`sDATAss\s]s^s]sxsxxDATAxxOutputRender>DATAxxxRenderRenderF>DATAxxxAnimRender>DATAxxFormatRender>DATAxs333?ʃDhCvDhCC(BDC?z?DATAsx333?ʃ/9DATAsssX^s\s8]s^s !  DATAsss]s`sP`s^s8=i>o? s sDATAsؚs333?ʄ~CB~CB ?BFB= ADATAؚsЛss333?ʄzCAzCA  A@FB= A ?DATAЛs sؚs333?ʄ????????8=i>o?fffAD&@??fffAz B? #<C DATA sЛs333?ʄAVE TARGA/t1.blend9DATAsssx_s_s^s0_s8=H>o?UUU sxsDATAss333?JzCAzCA1||1 A@FB= A ?DATAsxss333?J????????8=H>o?fffA*@??fffAz B? #<C DATAxss333?JAVE TARGA/t1.blend9DATAsss^sX^s_sx_s8=>o?SSST`spsDATAX`ss333?ʅB̽̌?B̽̌? #< #<`jFzD SQB̽̌?DATAsps`s333?ʅ????????8=>o?fffA@??fffAz B? #<C DATApss333?ʅOAD FILE/9DATAss`s^s0_sP`s8=i>o? 8shsDATA8sHs333?*zCAzCA A@FB= A ?DATAHshs8s333?*????????8=i>o?fffAD&@??fffAz B? #<C DATAhsHs333?*AVE TARGA/t1.blend9SRx0 t`sSR5-ScriptingȋsPsssss0t DATAȋssDATAsXsȋs DATAXsss DATAssXsDATAs0ssDATA0sxssDATAxss0sDATAssxsDATAsPssDATAPssDATAsssXsDATAs(sss0sDATA(spssXsxsDATApss(s0sxsDATAsspsssDATAsHss0ssDATAHsssxssDATAsؐsHsssDATAؐs sss0sDATA shsؐsȋssDATAhss sȋsPsDATAsshssPsDATAs@sssPsDATA@ssssPsDATAs@ssxsDATAss0ssXsxs !  DATAssss0sssz==o?s`sxxDATAxxTransform PropertiesView3d>DATAxx3D Viewport propertiesView3d>"DATAs`s333? ˅????????z==o?&A*A?z==o??????*Az B??=C ?@?@?@? DATA`ss333? ˅/9DATAsssPssxss??Pף L+tXs t tDATA tTransform PropertiesIpo!>DATA+t p 333? Yt> =DATA p,t+t333? CCx??|?DATAX,tXp p333? zC̽̌?zC@;; #< #<`jFzD zOBzC̽̌?DATAXp.t,t333? CC|||??l|w!wDATA,wP wBO`AzDATA,P w wwBOp=AzDATA, w!wP wBOq= zDATA,!w wEMA btDATA.t.tXp 333? zCCHBC|||?CFC= ADATA.t/t.t 333? ?zDzDBCl||ll|zDzD=HB DATA/ts.t 333? BzB@l|llFzD #<HB DATAsXs/t333? ??? ???? A???PA A!O?j?}GCHB? Az B? #<C DATAXss333? /9DATAssȋsssPsOXtPs t@tDATA t tLink and MaterialsEditing>DATA t8t tMeshEditingF>DATA8tPt tAnim settingsObject>DATAPtht8tDrawObjectF>DATAhttPtConstraintsObject>DATAtthtEffectsObjectDATAtttHooksObjectF>PtDATAtttParticle InteractionObject>htDATAtttSoftbodyObject>htDATAtttOutputRender>DATAtttRenderRenderF>DATAt(ttAnimRender>DATA(t@ttFormatRender>DATA@t(tScriptlinksScript>DATAXtPs333? ChC#DhCC(BDC?z?DATAPsXt333? /9SC`0tSCTexDemocenetageainzXXtWXqW*??*??*??=X6t6tdd??< d XZ! ??PrPrBB?????//backbuf/tmp\L?L?L??>??_?D hnpDATAWzqA0#zDATAqzqW  zDATAqzXqq.'zDATAXqzq.zDATA(X6ty,d'=A@DATA6tL?B ?o: ??22 2d 22 22 22 22 22 > #<=2 #< #`fff?Ou<?DATAHPr1 RenderLayerIM(:t IMsteampunk.jpg7h:\Photos\Lanz's\display pics\steampunk.jpgaa(bpW$??DATA(bp DATA JFIFC    $.' ",#(7),01444'9=82<.342C  2!!22222222222222222222222222222222222222222222222222X" :;3ϭ7Z%g֠+2|>L3AՠSOS,}R>'S,}L|1U*}VO''X+|>J͏>>;>X~MLвVBQ$&k$ @lH $1a5A3A3[>e}W`$D ILTDPuy̜-ӣ<-lV.*LI0VI0-I3I'̼v-"HMI@ 4A = Ϥ:h;\lG-5BՒȴ !(j$1ޫʀ^RARa%fb BfĈWC-gOlWB}?4/;KȵdŢ,&$YY,AhI3|,o?&x U@DdDG?W^SDN=#ShRŢ-|w&ka1%b&vo!$!" A0]D DTTBf-T[Pho6^+McB[)735bפD`ė,^k%b$%~[yP;_VOՋYIDA%HV T<^Cnݓ}=r|ض d2;;/1%-jؙ&`Lċ@OoSW?V,MEmR!QXR+jUe,'8xٝmC1|rdI2Y5%ܵ%ڶ%I'̼v`"&PEf¤B"B1N"o_[SaNׂ^ &o[H2,63_ ̖s$eX-jشdI >X>WB䕉)h"DZE<)[A:# ϫagHYkazͿ r[d!k㹒Zձ3Lʼn>X>W#4VV+0B`LJg1h=1>,zӟݏWX;^/ӛӊ\2a^^չ|dtIedvߩ "-QKT"&KT N+d47Aϰ:>]sO.S'Ϣkkht򎮖kjY̙p2ږ-hش\Ӿc,Ĉ""E+h+[y]"y8uM{)69A^Jbc/'HtsvM=1ӓcɱv{^Oՙoz {ckVK^d Ǘ\~e4dڤDԊZ?{:殶Z9w4v1c[DdM.3ŔԚtgBƷ;g\;YW!ձyZ/>u?4̘!kzL'GoL0Znkhjd؛1+_dɱN;| k N^9?c):X \Jm4?zNd,Z>y=?ߙ}0̙+[TT9u.΁&`1|hlśxz<}QsЯ0h6 F œh)9^KM&[R$<of[T EG744w5 Jo`ԜL#wvMn>#2vٓn;> YyMMm[7Csz{- Ð8d+&dVOyO}7L3V`D u lF]Lܒ5/N>dɏZs՝SgWclN}6kl7Sg쌸|2bq\d/j\sc;_NLȒ0V-UBi8F=y+11]L\&Ie.*awɃ!7`Z2gly 䥌Ő`~e2 cJhF9Wuy-Mc&(l`S,FPl8}AϹl}Y8#gZNuv5F|CU^d딋VKR`&|ǧv/"`|f#,HŖYq塊B)sb9-XZ3kCƩiɎ?l1:`+{PLYJ6,ƮɓoWd\aRPË63JV1ɄNj6#2P[P|&2$EW-2űZ䯌dE$ͱ9\7JCwt+)k9ccgO9>>Mf qcßlf y0J]mcFr>,;LDdRv cty[ckW8Ŝwx󾞧ǐϛͬ c=I[9uQ<<ǝݯvkX厞=Ѝ]!=FTnWTnPmHmƨQy3[\m_Hn|~CnhO(ug:gˎ6X:NwPmJ)\C 6 p º[wCs".ߝ&µGK扩sѱ7=/0jπmj6t\3j@Ώ;yҭs&·Gjt ͽG7:'MC=hb0t4j:]v{\Wl#6c[~Ǜ\@&>i4-PIѮX9if;ssMRs;vU:G22Xhç8ѱNu ;3+503a:^{p65oP& F|µCoPƋfMVޠ3z`7t{F^9:57w8M}LS/hȹ-fe=G'N |lM72! 013A"52@#4B$PC`CZ{i{i{i{i{i{i{i{y{y{i{y{wo"/n޽۽{wn޽Ƚ׷{wn޽׷z/o"^E޽۽{y{i{y{i{i{iWdmv7)߽GEn?@YN{Z*S~יM>יMO7Ƶ{+hUOL~Ǩ2Zv$f9Ώj2b9sRXbF-=8Gy+M)X,P\Y֢=1UJI K2]̤Z3w#է}=TiDq_=Gy*7i$w1t{?o9>8Gy<~KRqh|a%Ѱմ{JXHJ!_n/P^e?w#lRHeZ1fh lJ|Im$csG Hč)mW;,@ǜUE&@i鏨2T3$ӑ{iX%5,#vh^xSwi$5Co ܌[ kus71j8H6z)pHԈ䵕g/WT= +~G2 f7W8ķv<s7',7fkJ /fWf#HKMPʖbJb8S@JW=ț*;'lve,h7̀JjԷG}Gyp),2WHw;eKgEKT5it,U,opqcKq`)|^@vs#^>M诌O܍ fC=%E3!hsH2F0Q^e7wJ%ᙬuh^pvZOC2diA1'&A |~Sy=,5?;V֔PV pX G.M.0xrGyMvV"Up9ӂ'O,zwuVݻjC_}2RȜ%q{s1wYuoqu8Sg2^6N6!Qne7w5r~&O;Y8lnY}2ތt~v;Y7iP|/CW2xN)Ȕ~iecS. |9Z痖5F&sI1PM:/dg&ux<15I!ZPE&. ~)x%9^Ipk]!Ij>[!9 /La#qkP!0ڌ2HbǦ!>.]p+ϙO8J @8]|cNLyc!}#;HH IP(O7#D6n-71Ui̧J8(l^r Ւ'H2EJ-Ɏ^Cs 7M+Xa1`:W2QEQNR;g[[m ɖ6cwnW,EAW:ws 67:xY3~ )0b0_~EQEvdwQXZĦL?7.!lc dæ(\ zW7Σ4q|a{.DaaB/vlNj+C!һzQEQY'Muϐ݃ n0_np<n[I(wW}ޣc!M+uAUi̧q('RO6tkwSLV7+әO^QG8%M _A#J }? !PA7w)q<Eq!y#k\EQkdWt nl> :W2QGE9QI`:or o }iYAcd8 ޕi̧ *pr<+md,Λk^L?pp:_~ p#n0m|:l ~Q&d NAëz8:W2ODxk+oe|/em.zuh,&)TYs4/!CNcs/ZjR)Z_/*׾^{W^6ZjPj|Wruyiy+<449Yyr,UiW+̵*_;H:F&]W0ըB֨Z ԯuRJuKU/wTB/kK<#ՑjȵdZ-YVE"ՑjȵdZ-YVE"ՑjȵdZ-YVE"ՑjȵdZ-YVE"ՑjȵdZ-YVE"ՑjȵdZ-YVE"ՑjȵdZ-YVE"ՑjȵdZ-Yx҉ I3`љƕBb)rkC}ĩb1;XL\rW1IH~JYc!a#iY&vVU4xS ЪR[%d` S*;詃L_MolnIv2>, 8erO#g3 SFIP@a+Bꉌ6 si|Og4wANN 6zҝ gYYJ'u,Zޖ"c}Q&P)妕Gc6j6/K 5'M51մS!Ui0TZU&lJY-uI)vQ k@fmMiW9 tTB8Q=RU i7?__?__B !1 "03@AQas25qr#BR4PbC`c?D/Ү+ãzF/ãzFѽKãtrޥѽKãtrޥѽKãzF/^Լ:7xtoRޥѽKãzF/^Լ:7xtoRޥKãz/^Լ>7x|oRޥKãz/^Լ>7x|oRޥѽKzF/^Լ:7xtoRޥѽKãzF/^Լ:7xtoRޥѺ9xtnQ{[;Iϖ5_/gpg7w>~;s>ZZ7YMN!RRm뼪L\2հ_ϖ=mTLvw.+q-Fu/37vbXZޭm=g k.= ӵX'tx^Jp_ϖ*HH8_/gpgYDgY~;s>ZH5Ֆ+EVv\ܚvfmK-*SX *ګCpp_ϖdmXUFn ;. ܯ5Y~;s>Z̷?iN[qƑAu/33嬵vZn ,I>D#HlL<Z,y)SDIi[ N xVdzԂEWqwSv.)}&r-%ViLvݺ.SS XV_@ PJ[c«?U~;s>XPcCbv~C"uL/33KriY%}ABr\ l@@>L/331mZ83Ң*J&;J!+_/gpg*'#hSjС''7q(mkՇG*C"H_~;=\1MoF.)ED(RTZlYU7*ӵ ma|ay-Ny٪pUq]M҈mWu+idTͮa|ayj9lQׄ ;hV67yY|貛좷 'TYYAZVrrH)fmqeUWk&P;sX_/gpgzY58άpVX[q] &DEMoܫsX_/gpgP3bₖ6HU:Vd[.5weZ9W]ҁa|ay,RĞ,3E7ܪm^*ŔU+򮚜CRڡ^vnaZަH`iى3z6p_ϖ-ouFBoVQV+-ⷕ%8[INs )X[rqYۂ,lȹͭUhpUfg j\Um ngo4Nn qLX-uR,*E^VTؤ+սNR|ay-jZV+=_> v'7}8*ToYEd7T [iSyd ަi+L,ʶӚ~;s>YћܤYf)[rRD&poV d71'T2ʜcQPY3ʳbVtn ܐs jVm>ӹHd`f𲯢}i[28 rDzpRfS~X3_/gpgR4LSRCz$Thtra$M~wS`h J TdIMhř/33A雔+ pUa5N!Y*Avd䬖";$n o61o@{6SqEg_<ϖ}%JJS%WoN#_ܑEYRn jr5`Cxj)/33TS5blJB#%#zEbk9UսMcxBaMUZJ5#3)zx_/gpgv͊$7o ЈRܦ/V^%Z3bVdXL rěJ(1 gfoB)pSS e]%))xBT+mV eIFO83_/gpg;%E]XshSmҤq_̖#zqQ~;s>Z`*IjV 4,@6+1F,;Ι$ho2) 89/33垞D$h(559ZVUX_/gpgzXSJ#:$3_/gpg?-JDXWRE9Ed<^UNa؃8_/gpg?f4NSALVnlx_/gpgW4I_m6%:-gp_ϖjƳ!;w{ ecic|a9-TDLǕ2gp_<ϖ(l/33WQ!L#(jx_/gpgS2=Wz8!:ogp_<}NsVPBbSM9ث3Aw Fc3taHUoS&_O$?45?4 튫NlC/)s ]k z(?>E6AĉOp;Lgn$?:'jlAY51vп튫R$?rC5 w3~!.'VlAĵ᪥{%%cdC2T&IAj؀/{LK]X%ot<{OQ|KOYCQ2JՑfMb%󢫻'ZDK">NrɈ^ZF,k7!S;1+U\*ҽ:6ǘUkgAJ Z!S;ӝ]:Yڻ7O LZi_u-/l ٷC䴺g̣ Ҷӭ(=vn>A``&jrذv`m-FBh dCJ$^ϵ=a0b {ffI;07wQLqli gj ` ;[Hrc?vT og ݓh[BŒm):3t(Cդ;K7®{Dp(qי]zR`W9ՁZPg.3_mCO1`mRP"V"}H1̩mNզ08> b5!pӰzVu bs'}y`[#lOsp` VRvӷ~~,٘uilOSn*&1 rhl6cn: HB# PUlbbu,6@ kLB-!1AQaq0 @P`?!Eys&?CLh||/||||G|G|G|G||G|G|G|7|G|G|7|7|G|7|7|w|7|W|G|7|G|7|7|w|w|w|G|G|7|G|g|G|g|G|||G|G||?|/||Y?QN3l_ 9ɕDQRJѸӢM%% .({!ΨzoS[Ƅݕtlc%4&(}`083LQ`iȡIRM k(;!:C_?Y3e=WbkqI+< n=cIx>3MLzdΆtD׹D7>Fz%TTتu$WQ1BQ9$_V>Rc_BISs(<&آToA*taTHbkw2TQF{ drb؈6}iТ6z_'tvНIDFr[wi&87 -A 2}-Mw% Zq80ț]sЩx8=R~z$r%kdMFvaJjP,n^ǧNvp$C`Y&O&zg1$}C $g0E5An r#J2č"6fx܇ 18tkj{ju雇:hxxa-WEQ91Rkgl $iN4h 2hG}8dcR/TAr ;Q L*j CT!MN 'ुu"=&Dɲ837<7ռ'J:qK|dbxB[};$^L a6$!Ee&/ e50(p!XReG\lt/=' Yp{,VDD[+'ܛsRT?Aj^71iI0Xh:L4=MLXܱ⬘3BJLE !TzΜPM'kNkDI2q6&XM:IMN eNMw&mFdgI⾭}H5hj4FWht/7p>Ffl|#ΓS 4p\n9Bt̚dRK-䢕$%3&_F\s S-( 5%l[=  MGq[f5F-} Xzkc[3}[ zh. ނŲEܶ}CJM##M:ʶCr -ؘ/)4FW,i%H СQ+ӶÔii <182Ÿr7RRR+]4hO!fVaGx!=P2GQəӂnu~ѿ"x!&ŧ-ێ T3O%)HM\ݔ)%&]Hi/fN%(V{Ms%k:\`V(Ҿ=:kDƉ,~cC# I9I5(| ໔Չ##ǂ'XDBq"Cɇh]ܳ#H'oٜ-t}#xox` !Flsal^zviMl, XsSD*fO{w<7ռ߂OfG44tcwC\Տn#dJR?J$f3: ŽKvh25K4)' 'R::.⫒;tì-м*aٞP^$s9gs%{2dHn# 4|7Rk7ܛ blWb],oJP,G*5Jì[܆Ph/*ct^r!GZ q%5&m.ZcCKT;{7"l8;5 }>M3#08do%#JOHrCJyM@ Ä,)&!G":hhPaT7"󱩂'RL7/C:pɊ(cSI4*e#idΦ(nxnM,H29jEq՘z1t4 V(H_ð7hM%j&NDQ1DRep*hQ2ixx`; w1CF =أ:-ȄZ':MC'M49)=&"pz.  ⾭hҲvY !ЋR5\n=4+t\kF2Z* 5RAG"x]fMk`yІ+oQ8*Za YD1Pr KTj !zp4X|x?492h4F T,5Tb!=D0OGc{ L?(XhOc&8heQ [;d= ;2$t;&u;tOsC  liE!Iݔ`4l!र` u(I6IpM@`jR2h6\PapQLwBdNe`[H!7qADzYV`IHJjr_#̱4(9';rưR@A (K5TU|ٕQ}E 1rLo-kE‡qdW[(^A bTb*3xx`;9'a-.CIɊ REU$("'В I =ȉ}gIq)6*{?$$1mYf@ԉnl`7΢v5/-"g1+  ؓ+ u<v!ccō#ؙfioQH 4dh-iED64=*iEXHiBiR &^Iu=D9ؿQz3O< qVnIr1҉3ߦ3g! Ĕ0j,"ladݸ&N,H"2ރ,hobSݑI޴).ԙN@jMNfKyje OY2Dہ=M0, 'Zyd-.:Cc443%1pKQJ2*g}O9(jYި76v76L(AM4ƑJteFg?a)\.:|d'% KHע~%`qb,CʱI9TD6-ef5!F4'X# -a4H#=zs'xBF4ꁓHƗ]#i !d0gCV,?Z"􌢰> RgB&P7A/ 2]D Tȟg w<%l<տ>Š顱{6w9j J6,h_QTZнrHzA-t# Y+E s苀#n&7ij'6#BDGgY.œ-ЭB%`EDH^(>WY2 9c#^Ԫh&f, kjRO#RqbXP(1+ (!T 1V4Qb\?hW-^0vC$sl ABi\I+6R]F;FV~ӳ bDlzGر2 hFj$IǦ&D>8ZX{00ؘ8w"r2^$28x%!%Zh-'9M*ՉPSphV.HO 6]ԷGfcQY=3öv!csLK5Yb&xobA{2}5jg8lMPVIE$Nf6FZ}Ɂ1Vq*r%N2O6#!DcZnHhՆvȲ'`#uRB(q`KQ`V; Di7 ^D1(59=4ԪC,e9 1򩊲R۹%RDPJCӉj0W /3~c`نz9B[jgTDoVdbC4gAXkzfI0I M}&C:,ldjዸjdS" 2%)=`\]H,hFzj ,+Z8 M"'u+ĜbS"mK^Mkw@s쇥~T% yo؋z_B5,@TB^7GWD`*yv8Hۍ.`d^rTj366c*j Ӡ`$O"d隂&r;:xi9'OQa匧*HHRN(Xfļ>2Y1SMB"*"{T45`hyLqЦcDB ƣ*cO,ylc /pAFu*8l<>s6K lLY,ŪYD7旞WM&tF۳_(t%"f*\A!Rp+B[/\ Ǡ_&\5fVQ,3KC!HjmV4ĈMV yr4)<)"%"Em-ռKdb靖&"Od|1bH"١jܘؚBP!2D-)"*r:쐅lJӥ!))H x"$$Vb9:#$dʸ"MI53}JyͫSlAMj`VcV01)tH*3Rq%I(nEV(*XPQDPe DUoTlapOѻ&P[kՌnL\͒jv 9j4UӖ"ma!Ϲ8e&8 iLQ)8M 2)d5k )V hFbѥqJ,D:|S)jIOSRheGa5.F! ,AIC JE={*ZfX$ iJi+JefވR:j$lH!9svu!zZ4΅+&D5\K}5 I!OneY/&[ ԶnMLf \ Y>sOBp"8 >E|l IFk#G1$pD *)-ա=+j% J" p/h"e bE'<5}`Ad7MQ,<EMXM)dFH%N4B$3݊&Dkɾ +Y)czQ !) `D'w !oB(B:P+9]&nRc`%/e};5fM2;F̼ Ez,#L[8-w4R,zg0!mV sXYM¬Px9"[M nDʇ'"EE`l eQodJ+R=qI.<ƲlMɨLZ %w}hymFjcC((ׄHvUۉT1XdXߚxSIMSkakm#A(mU3U"eÙ) 6Jفԃreb31qRނP,$OjPfY/%4FL{gFB7K#q8Lj$c!s&Jjl"; 6^ h0 yɷINP4) dYRIl/I bi KVAOA!Vqd'k"t&Lks"EN /Q>GKt#`|*tJYrŢn" )nӲz2LWHCM"Uci53QmA*JZI y-zS+['_a4D'-?!DyHϑLSrħԐLgOoQ0JǞMROU\^%,kZTB۲.V&!7#3m61*hHySy[8/diB pRSb[|@mIj% TPdB0 V✵XdZT䫼 xa.Fcc &Gc}p1G$cZؔ$aEZJJD W[7!- MIȯsXF75X,T#Gs_BeU#i(X=^PRy[փ% 8FsI#GeY\I##{{l TɛV`ty4 w&c@ECvENs4MLŢ14^4/dNYKQTINO֋Cɫ-5cN5]zEed wPd%Im Q: e"vu!Ƹ"i SS `TԎJsF-ܚS%JV5c4Dg~6I/BΊx?iNǼa^<c v̍Ǎ nEPągb5 S) j j6˂5bGec +jIxU 9 ĠK%3Cj) U ōb1֋ BCnTrMF3!eє%"$dJhђGkFR4=rV<NJЋD)A]S9BT:%h%,D*/wMϭ8h"b Y[;nAPN)w೩RɩI%xؖj@1C(I MQ&l~qFRsɨ(I 82I܈Ҟ0rBE n3Cʧc" FՐ JNJ rB ܠa2`Cfp=xcQ*pkbɸږ5^޽E-.ImЇeFncBV`HiGk<29~ 4XKeQ%#7oƃdk%Eau1Dwcaޠ+UiEz|)"A0ihEk8K!([zn}oHTحC6*!e )d% jB*1N~_Տ.ǃx<M[P5\yDlt[X#a/5K> kBN-P(eNSm=+`<:%*;d56Aev֜Iӥ.Z=M'E!V(Х<Ѩhʼ}`aَ5SQv|gϝ;>v|gϝ;>v|gϝ;>v|gϝ;>v|gϝ;>v|gϝ;>v|gƃM6K8."nM.zfZ؏u6:e3R_`NB{=S_K@7gnfxۄ3"K-0nȚ;|R_[+ItS"eyt{QB5=/ XCi']S<1_O g]+<_Q)%m)_߯7ВNTLmr N}s݈D"^R6B]vˏt/se]v.ܑitdQ!HvF'CI=GTP 6ާ{?4/W"MMSq sOՆ4CУaMvnQC[)knh}gN^كG_ H-nߎj?ʓ1S"[z y?H9S~^ q!gIHb 1@Gn K9}RR,{S( '?2]w6ϳ K޽*"lW C)OkbS7bÆ'pNcjyCo؁:ȁ^RDݐ@CIL UN`C]^e$s~`ɹ9O԰'>dXLK!RH#- $%C{.ztk>qHo1"Ma3 nc&d8ln K:O R12KaN,rjO4o? WhRX~V\e gMVcʢSѶ_Wbq5{ ,oZ hJYdO lrvz%vCrRܖwйb,3'u ׺?3ETǒ^_+F9BrĊєqIY gI Qrhؿ% Q6}B&$QRQ *=pGCTkд6SETzZ\Ƈmq& +GkM-qb35De5=k'Zpȓ^;MCfoK؂0CأsBf^G ]p F1C<ӎ8 L $8Ђ Ic @DC<(A $ ( r 8$$ 0Q8QqI  D[ CxIwžk7R%›3=B <Qq-y;Sb{LYO )@-T+<p$ڌKbLWAZI]gljBYLboKgkux%) wG1# *=axf^"ތT=\먫#ROXgUzhB,XPĬ C+fǹ`Q.۸U–QJ.U@\B}[-p˩8KTKLja'g9[6'a ppcEz3 30z҅^™kjqdYBh /XбZ V*RK"|C1u[ns+`e|bವaj^Q0Q/0#/.O(88WUr!ODԺ0K)q[ 1ی7lil.mKhc!} b,uB'u|YxW,$kbqKAg pn`: icw .2w,6'6h uëB,q_FYW5e\-d#Ɩ` t3<)]8?4r{°D@*,bSp;:zZ۸Qc0k~3qj9uWqWJr %>`,mup3n&!nt)2碥 QMe`sZ,=\_p+fyP b/{!l7)WJ#clX$M Z:eM-R,zKEzWlCY2HV5^g׿Qc?X3I F \kFɛz8NV?O'y YEWq:Z@"dz#FZBiBiBh&<w^p0 wVSO0}Vsq WF9ji:8Aqb;$)OOs1k,&zZ+p [k.X[s-A,HJ<)ķlputq?km"Rɑ-`S yQ:mh8{8v;4eTV2mWz ; X}biB7EnI~VИ0v^kQ S/S64C w05/Nd(`w5:lSHsmZn9ܸ(O1TvCNa|"H*o{=YvUAKZ!}H򒊬F\LLW,wMR̰BהN}R JD, (&4=A|űXjEqŜP2sOFy;Ի>F&Hl8Ͷ4 [*ıj|#-21B\A=2=3Qc9!tH R_'Յ03ݦb;U"d78q9/s-S ]52@e%P\1E{i:fZ8pH#e ғF0@ ΆX 휖i9`8(rR[N9m,8DkM3G/\vZ9."mvDc ŽYj m2^%Ag*׈MDz IUYr!wo oŮNjhniC ÉaKkw r-Kvy6N pAµVq6Z^gWXPk̴qRϛV|N^/ԑ_ɷ%6vc2 : T'OqvBS18zUE͹(62̀13p5)KEVqpuQs:/p_Zzq"3RvmMELfVd23pH\AQ4:ucJW A_0G:%E.a'aTۤjw;aƞx :%Q, WPU y+0>楞$P9o-e-I o *?hvΝD]9JiPG2VDUn44[`1 ;e"Oix-b/Ne8TrF둁g*(X nS kqqT}c H]&F=B%3]cek~bѓ1#ȅp/ QCOlnur.$)Ae6K/ɵЄFE1C-9?<Ǟ n SV*etB/*Dyb&GQ+D^ЭVbrxKbI*ULX [[f~0W P^bB$)"eF!VBy{s2ӏIV [* dŽ확w ?Pm#}P Jw3YnzؕK7uwI*@:HG2 5UC7%k*Eb¡__#=er&"1t˷-D!mW6P፠,D_Uu:[oخh~ӵ&A ?ip(!^,.M,@,M<\dWqSÁpVbMF*ɽ%[ƙb Z$PK![9 y%W[N FdDqW:2ɟhX}A4 %'1e;9A ^`aj+XC@rnD:crCLE}"g,H2= =\go0Oy):Pd}"~&2xT.z60`<̔mġћd9lɡx1'ľ["ߤH/̻K\">[k2.+P\QIJN*vo0 he`q(Xhq2eLc P vy5C.BY%5De y 5P*L bLdr``̓ƞ@oA^O!ggE7!l! cqq@a+bb*%mKHWl&&xe ]9㠃Xƴ^D>nyy,^3)6w\ocƂ:Ik%Td;:9Z!\jQYv+O2Р0.KG{Qze,>.**X߱ĈX85QϖfEʺzJa̻ThPpk 9)v5=4Sn(LEߒWCWXKԫ,Y qR UQGL^#DܿAp <%E{$m9]=DApO\",[jS6֦-Tq5M&Wy冢\&&EV%쒗z 3\h\h%VXxPF೬b/ldW4rbTj-*B)nc0sRa!#o:ie9\9;ًl@Ҝ`?Ü\SVUq) Q˹|Yڵ(rÂc7.;eh+H1YijcnB-?PZU^/L);_Z5ʓ1PRžS$^V#`-} #JFؽ"%V˚9@ˁ2jP4A)ގ%M4%z8+UF/pwQz90pr?;cۦj*xfVg\b)M?P23]԰eی"PCԥV}Ifb01(ѵԪ,,l[q ¦ )x:j'k ҘeiN>W1&.]`Qo?.!Sm3 K쎪?S, ̽;1<] Lp"սC&j,whB QC4>7_K"-5lr ~5{cXM0{y;Le,^^ˤ)^zuT_ѠLGHIG`%K)&j=6X(ǁgclfatri/xQT/:M}%D^y@21˄=ꢬ̏:AotYqRK\,f;Y". q6UXɽ7O5,23\MD(m$娼9[.,[6q01P/95vm U#^j:[{cEbتEG }ӀVq2 00oL䩑U̡٨Z""ùP 1rຕ6&f(2V55P4Fp̍%Z" .OppK8/C(1q Iy0z"l6E'V7W$m3̸wz=Dȯ7M\JJw*) qb^X]5zM~tߘ!ɋȘfqb@f}ϸ"A-2rRXķlccs;ܢb, yXIEm61@і5}&eLbR>c iA([.q/lL: *?iA^eaWi#zr\6 \F⍑HSrһheF-mL=YN2h`NX2L:"8T-‡Hۦd+ÄpAs>w*oj&ȾׅNɎȋkqҟl}w 1qdZkIzes<NJ7IB(==V&1E**1ܺ*yV|2ydc|9[@9!`zrUUCj [9Jо&/[.C(ۉcX:%r`~+T!6jy,5~B.:hj g&j9\*rL]vK-Ń3'PL)R)j(p0/!a1$3^ҜK^&Nsuĵ([ϙ*Y{,eYbJcd Pd؅-1^%]D[EnlK%PA<5(nV-1[L4z%SaDzKGd#;HYa:<5J5\5b99bk+ڋFRǢ %3;Ht\T^pzdAvaq* v U5_ObJh^1Mn *x?HS:?92&5Fe"ψH[ Q1 oʱ%>8bĜbHJ b :Fjl4G)xaqBoDUЁ|{LKb8Y}c$l&Zҩ( p<0 dGaF C*Q qpbe[K_Z ƹQ_0_rm*jXS76sAÒA~uSBe Cvp,3):cK5̯&'ka5,rA9 \{\<$q)nΉ^P TZXm-DCd/N%.jY\!mCuJz3(ޗB6)~tm4@' Eśkqf*d1m@v$@F7mBzE;;̣3>(" xw-v1s4H]<݄P2x !=r0ioRՋ`ZVEutmInlR*QD қjTUM&fnK|o{-r2OQVϲ* Ts4C :TvvXIJ&ޕ k(n_h&`g<aŷӄh=`U41rcө/ ӈM88fM}3#~1\zz9겑jZ ]9p\E-R }ۍsBv#TQ+W&xjVe0*&şxHKKy-Y_qP\Aw4y|8wvpUbˍi,Bcx8k h]OL1qp%X䚍 9 & 4|ڦ GZ\Tyoh=ٮؕQ =pq+7<WT_XQGRoOSR̜ TY(RףF̩mJ~v'J%k]ʕsarbag](-21T^-6el0 V;v!U~cB$B*yhD`;G*Zs+LeY9Z]↡rb"`qlģ:0 'O 34 emĐ7/IG3,y^I (6퉂1۩ק0Q tHL vqe6ye`z0צٓu̠ ExDFFX73Q,Ĭ@A XnP,pV؊Τ9)yC^ӟI zHkV Y,Ҡ8VSyIƒkJXu gt6np -Yx6*ef: w6R9̗5 ݆/]:0m.^eA,pw i3/_j1d.5V}8Q;LNRHģz9 ŦȒʸ#wz1/S]VH!ܡ(/TEbgfܒЎ*$05Wv2 cF(3` 5 pT-,eC6i^Y>eYhl} *2c_ LE1*2NNn^2 iּm>o|LX^h˩OΚ8ik9m8 VEl}tÛBc W̰j!2 JZ̦Dk k*Ө̄aj6[cZ1]X&RL'I2[(ZQ}2=s.t r#J]rT.KV]PK$ݵ!Euiy"l6 [[~b6MFPK 0fP?|"ٔ 0XZ6[}˛}!RލTSs\qtiS!\BAiXYpAkVKT96ك:뻀3B}UBΙV- ;B ) A)ceeq3hH,C03GcX"n6W}#\Z`]Ɔ#4G \%GcYXE<[Xz!p;湀/_-s,Eeȭ7fMidGE *XcQa{[6P 0LTnfؓG*6阾uzVB 9HNչ Zپ[sigKBC(&Χ7 jkH qAxL'QO5 HSfbʧA]aJ ` ɠ P.n,v70荫A/!nu )WA0{ml\gH腭,lPh7R0n4Q*i0ٻM@u*~F`91c`{(ܠt1sss1rj&wT;r4оe@ܴ5fXaPUWVd XSmғH$e|8JJyJjA,dnB~`Sl199ߴ8;B 9,Xn+E3pRh5CA9ENKFn=E8 7 m)Pj^m 2)C+W[${(r q-;Q9 PP#'3i1-i  "1ag1 LzFmB>\ʚ 5W>%T,溇Q)/m^ ,+*@ ;:1c\%Φ0E\J/8]ToVCPsRfb@(HŪMe٨J2,:2IpKU d=C%JZk5ɄqY*]{B 򕂙~ʈE]AJ0INzԹf9rC!pL93,n-l\n@7r@O@R9Kf0l 8UEq{!$c_LB\PG{+!aAcqp!fᮍ.VRe UAE3 *qd1Ųy"wm48B({BTrs9a]Fu͕4vXxbS#L!}풸pHyS6 DN%'hTn\SĭJ/z`biǶ!T[ w,B+/xތml2^"nYaVC'0m>!!j&n4ʈn e,gN5pl6]SW,l%W^K*vn,J7Aa>j,X',zbF1*Ü9wxu1f$RQ-昂0ISU&iW =QJrdpDR3YE[$}6F@[ i" u5t_k *,󺬖G{51B} 1(WT,)Cp-`/HGp+S"S0 qBt|J y@N=Wj/\VÙc2D +@9ţ癒^!u:Bq3`Qs7AìFsZ}!15n{!/0ݴ(^n5oX)uFGK%XYZr`(Sp)\|;eV \] `!MX\ A!iu(IBw6YHrLBScSQy9ßYcshwsЮ'ʙH \!Rpfx(ELD. l (+ξ-e^,.H^ Xwu0q`YQ<9uhOOLIw1Tk$YĹ`_)[1^J+ewu8Jc|-] ^E6KY4ŭ~b*LlWHtZEBs%aYWp pcFİ5 0 ⣱B ET \XAUObcoBHFų-nYiPlDսC yR D|J cda*E$Zu+b#!EV9:1%d]u]p#MAf *nf92v"f雎PZ_[#}xIJ6*f)\a~1V֘j_7Vo5'q+Hdb8wvOPss4! K6e«l9)H,op9b:-RoA l:1\n< !u FR3GDw]$׼0Hu[ Fh4.T.K D^15ԯ!\~b*e#f 5`knG}8>4MӼW5v7p7vn(x@?J+GVo#Ԣ$&/Pپ<|i7K|$W]TU_R!\&r^(Wg9?|pZ>"m[i=$S ~֮ЗCi"[3W_F*dP 9qިݭ9'7_bc d}AցkM)D{{?/_y^ _yai@rt$#쿂:J|>?.z7ytԟy';|R%)FXwcwsè?%PZE&3'e Gn*Ce+??cϴOxzE1xHAv t*BjZ}|u|߷>4p-c -4mIAI$t||T _l7p{[q=Ov*_ ѰuY5B>?Ś'P9`8?]&·gJtM?H+2iv|p]HWzWҧ/J?!ZGJzS |cs<Ļ#E}檮y^d(ڨK{~J%P?O" )/B5\V*kcF*NzMQCvGZ^4g6ZHQKzaCw}Aa+@Y_lj>.Gu(X4 <}b EŖ2 ަs|y`5AsOHO-VbXt*kN<"=2<eixVϵ}~2u&nj?t<E|RƬkN!{o QB+lK^J ng? zNjB!C> 2fS(,WC3l/ &4}CRF/𪑥W?XzNoIWOߨK:#8v_81oXI9!i©ݳeTm s>%vnN}q 6ϨԤp? B `UUfa`Qf m|f~( ﭮwhyFIZ`ڲRf9 P4Q+ 3+ҀFkSUj U$Lűz|gZ_y3`T8DZ&[`\pyHe[U\PџtꔒeYkj3(;U604=eDxc}Ut8u*(Y*ňPLqpV_DATA W YDATAY___``` HHHkkk ``` hhh___]]]???ddd```lllOOO...666(((999 222WWW```bbbdddTTT"""555...EEEKKKttttttfffaaatttbbbZZZ!!! $$$111TTTRRRjjjaaabbbttt999---444&&&hhhbbbaaabbb|||***&&&---,,, 444iii___ddd''' 111///~~~___aaa]]]bbbKKKyyy$$$PPP;;;;;;aaa___bbb\\\DDDQQQ555UUUdddcccZZZ... )))666ddd777&&&dddbbblll$$$%%%KKK@@@RRR``````ppp...))) +++AAA555```aaa}}}AAA---JJJ666aaacccCCC```NNN777aaacccsss$$$ ***aaaccc ---```bbb999%%%aaabbbaaabbbbbbaaaaaabbb~~~aaaccc{{{aaabbbbbbCA7tCACameraamera.001L>DB=B B@?LAp8t(LASpot ?????AB>??Ⱥp.?A4B?@@@ ???o:??????@?????DATAȺp$????C?55?55?Вs??????DATAВs"??WOdXXtxWOWorldg=pb>>===??A@pA A?L= ף;>TXxYtTXTextssssZtDATAs@zEERFDATA@zOBHzp zOBCameraamera.001 7tne@>N@???*?91<"P?ޕ/?5F:?81V~>75e?'?T3>ne@>N@??????}g3² B3?ș3 ~~2?43??14t?!E3IC3aj1?@4'5?OBd??)d??>)d?u=?????OBH zp0#zzOBCubephere(Y] bt@z*ڿ4??????*ڿ4?????????ޕ/?4F:?81V~>85e?'?T2>ne@>M@?DOBd8? #=?>=u=???@???-p.pyDATA@zOBH0#zpz zOBCube2ube.001W]0s[p*????????*???????????ޕ/?4F:?81V~>85e?'?T2>ne@>M@?DOBd?? #=?>=u=???@???00px1pyDATApOBHzp0#zOBLamp p8tp@?p@???{&?W+b=?6씾t? bfE9L"?%?_>oK?p@?p@??????#1n12?~2Nj`?Pr?5씾fE%?t?9L_> b"?oK? ?Af ?DOBd8? #=?>=u=??@???MAl(iv*^tMAnoTextureexture.0018??????????????????2?? ף; ף;? ?????????@?=?==???W????L?L?L?L==ff????DATA W }DATA}CsBsAr@q?q>p=o=op?q@qArBsGwFvEuDuDtCsBsArAr@r@q@rArArBsCsDtDuEuFvLzKyJyIxHxHwGvFvFvFvGvHwHxIxJyKyQ~P}O|N|M{M{Lz KzLzM{M{N|O|P}VUTSR    RRSTU[ZYX     XXYZ`_^^    ]^^_eed"""     $$$cdekj,,,+++%%%    """""")))===jjpp333555222)))   <<<!!!(((  $$$(((000<<>>###""" RRR... TTThhhyyyEEE444   lll RRRDDDmmm~~~]]]333  +++  WWWbbbttt]]]DDD333GGG+++ ===OOO^^^kkk}}}]]]JJJ;;;!!!%%%FFF777 666]]]TTTQQQ```jjjvvvgggKKK111JJJ>>>777555777SSS$$$CCC!!!"""]]]ZZZ^^^fffqqq}}}mmmcccdddRRREEE444$$$???999fff]]]```jjjppp{{{OOOZZZgggXXXbbb@@@\\\333OOOeeeaaaeeemmmssszzzeeedddvvvHHH,,,oooxxxmmmmmmooopppvvv}}}{{{ rrr~~~www}}}vvvuuu<<DATA XW K[DATAK[CsBsAr@q?q>p=o=op?q@qArBsGwFvEuDuDtCsBsArAr@r@q@rArArBsCsDtDuEuFvLzKyJyIxHxHwGvFvFvFvGvHwHxIxJyKyQ~P}O|N|M{M{Lz KzLzM{M{N|O|P}VUTSR    RRSTU[ZYX     XXYZ`_^^    ]^^_eed"""     $$$cdekj,,,+++%%%    """""")))===jjpp333555222)))   <<<!!!(((  $$$(((000<<>>###""" RRR... TTThhhyyyEEE444   lll RRRDDDmmm~~~]]]333  +++  WWWbbbttt]]]DDD333GGG+++ ===OOO^^^kkk}}}]]]JJJ;;;!!!%%%FFF777 666]]]TTTQQQ```jjjvvvgggKKK111JJJ>>>777555777SSS$$$CCC!!!"""]]]ZZZ^^^fffqqq}}}mmmcccdddRRREEE444$$$???999fff]]]```jjjppp{{{OOOZZZgggXXXbbb@@@\\\333OOOeeeaaaeeemmmssszzzeeedddvvvHHH,,,oooxxxmmmmmmooopppvvv}}}{{{ rrr~~~www}}}vvvuuu<<@???????@@????? @??<(:tHWDATA HW cDATAcME bt40s[MECubephereY]@zXdthct@3n@Y}Z} \} 3???DATA@z(ivDATA,@Y}'hctDATAhct:??II?I?I???III??II?I??IIDATA,Z}'@3nDATA@3n7 ############DATA,\}'XdtDATAxXdt6ME0s[4 btMECube.001ph'_p8]@9n?wFw Hw@ 3???DATAp^tDATA,?w'8]DATA8]:??II?I?I???III??II?I??IIDATA,Fw'@9nDATA@9n7 ############DATA,Hw'VTexh'_UVTexpDATAxh'_6DATApA????(:t????(:t????(:t????(:t????(:t????(:tDNA1̩kvSDNANAMEE *next*prev*data*first*lastxyzwxminxmaxyminymax*pointergroupvalval2name[32]typesubtypeflagsaveddatalentotallen*newid*libname[24]usicon_id*propertiesid*idblock*filedataname[240]filename[240]totpad*parentw[2]h[2]changed[2]pad0pad1*rect[2]*obblocktypeadrcodename[128]*bp*beztmaxrcttotrctvartypetotvertipoextraprtbitmaskslide_minslide_maxcurval*drivercurvecurshowkeymuteipoposrelativetotelempad2*weightsvgroup[32]sliderminslidermax*refkeyelemstr[32]elemsizeblock*ipo*fromtotkeyslurph**scripts*flagactscripttotscript*line*formatblenlinenostartendflagscolor[4]pad[4]*namenlineslines*curl*sellcurcselcmarkers*undo_bufundo_posundo_len*compiledmtimesizeseekpassepartalphaangleclipstaclipendlensortho_scaledrawsizeshiftxshiftyYF_dofdistYF_apertureYF_bkhtypeYF_bkhbiasYF_bkhrotscriptlink*dof_obframenrframesoffsetsfrafie_imacyclokmulti_indexlayerpassmenunribufs*gputexture*anim*rrsourcelastframetpageflagtotbindxrepyreptwstatwendbindcode*repbind*packedfile*previewlastupdatelastusedanimspeedgen_xgen_ygen_typeaspxaspy*vnodetexcomaptomaptonegblendtype*object*texuvname[32]projxprojyprojzmappingofs[3]size[3]texflagcolormodelpmaptopmaptonegnormapspacepad[3]rgbkdef_varcolfacnorfacvarfacdispfacwarpfacname[160]*handle*pname*stnamesstypesvars*varstr*result*cfradata[32](*doit)()(*instance_init)()(*callback)()versionaipotype*ima*cube[6]imat[4][4]obimat[3][3]stypeviewscalenotlaycuberesdepthrecalclastsizenoisesizeturbulbrightcontrastrfacgfacbfacfiltersizemg_Hmg_lacunaritymg_octavesmg_offsetmg_gaindist_amountns_outscalevn_w1vn_w2vn_w3vn_w4vn_mexpvn_distmvn_coltypenoisedepthnoisetypenoisebasisnoisebasis2imaflagcropxmincropymincropxmaxcropymaxxrepeatyrepeatextendcheckerdistnablaiuser*plugin*coba*envloc[3]rot[3]mat[4][4]min[3]max[3]pad3modetotexshdwrshdwgshdwbshdwpadenergydistspotsizespotblendhaintatt1att2*curfallofffalloff_typeshadspotsizebiassoftbufsizesampbuffersfiltertypebufflagbuftyperay_sampray_sampyray_sampzray_samp_typearea_shapearea_sizearea_sizeyarea_sizezadapt_threshray_samp_methodtexactshadhalostepsun_effect_typeskyblendtypehorizon_brightnessspreadsun_brightnesssun_sizebackscattered_lightsun_intensityatm_turbidityatm_inscattering_factoratm_extinction_factoratm_distance_factorskyblendfacsky_exposuresky_colorspacepad4YF_numphotonsYF_numsearchYF_phdepthYF_useqmcYF_bufsizeYF_padYF_causticblurYF_ltradiusYF_glowintYF_glowofsYF_glowtypeYF_pad2*mtex[18]specrspecgspecbmirrmirgmirbambrambbambgambemitangspectraray_mirroralpharefspeczoffsaddtranslucencyfresnel_mirfresnel_mir_ifresnel_trafresnel_tra_ifiltertx_limittx_falloffray_depthray_depth_traharseed1seed2gloss_mirgloss_trasamp_gloss_mirsamp_gloss_traadapt_thresh_miradapt_thresh_traaniso_gloss_mirdist_mirfadeto_mirshade_flagmode_lflarecstarclinecringchasizeflaresizesubsizeflarebooststrand_stastrand_endstrand_easestrand_surfnorstrand_minstrand_widthfadestrand_uvname[32]sbiaslbiasshad_alphaseptexrgbselpr_typeuse_nodespr_backpr_lampml_flagdiff_shaderspec_shaderroughnessrefracparam[4]rmsdarkness*ramp_col*ramp_specrampin_colrampin_specrampblend_colrampblend_specramp_showrampfac_colrampfac_spec*nodetree*groupfrictionfhreflectfhdistxyfrictdynamodesss_radius[3]sss_col[3]sss_errorsss_scalesss_iorsss_colfacsss_texfacsss_frontsss_backsss_flagsss_presetYF_arYF_agYF_abYF_dscaleYF_dpwrYF_dsmpYF_presetYF_djitgpumaterialname[256]scale*bbi1j1k1i2j2k2selcol1selcol2quat[4]expxexpyexpzradrad2s*mat*imatelemsdisp**mattotcolwiresizerendersizethreshvec[3][3]alfaweightradiush1h2f1f2f3hidevec[4]mat_nrpntsupntsvresoluresolvorderuordervflaguflagv*knotsu*knotsvtilt_interpradius_interpcharidxkernhnurb*bevobj*taperobj*textoncurve*path*keybevpathlenbevresolwidthext1ext2resolu_renresolv_renspacemodespacinglinedistshearfsizewordspaceulposulheightxofyoflinewidth*strfamily[24]*vfont*vfontb*vfonti*vfontbisepchartotboxactbox*tbselstartselend*strinfocurinfoeffect*mface*mtface*tface*mvert*medge*dvert*mcol*msticky*texcomesh*mselectvdataedatafdatatotedgetotfacetotselectact_facecubemapsizesmoothreshsubdivsubdivrsubsurftype*mr*pv*tpageuv[4][2]col[4]transptileunwrapv1v2v3v4edcodecreasebweightdef_nr*dwtotweightco[3]no[3]uv[2]co[2]indexfis[256]v[4]midpad[2]v[2]*faces*colfaces*edges*edge_boundary_states*vert_edge_map*vert_face_map*map_mem*vertslevelslevel_countcurrentnewlvledgelvlpinlvlrenderlvluse_col*edge_flags*edge_creases*vert_map*edge_map*old_faces*old_edges*errormodifiersubdivTyperenderLevels*emCache*mCachedefaxispad[6]lengthrandomizeseed*ob_arm*start_cap*end_cap*curve_ob*offset_oboffset[3]scale[3]merge_distfit_typeoffset_typecountaxistolerance*mirror_obsplit_anglevalueresval_flagslim_flagse_flagsbevel_angledefgrp_name[32]*texturestrengthdirectionmidleveltexmapping*map_objectuvlayer_name[32]uvlayer_tmp*projectors[10]*imagenum_projectorsaspectxaspectypercentfaceCountfacrepeat*objectcenterstartxstartyheightnarrowspeeddampfallofftimeoffslifetimedeformflagmulti*prevCosparentinv[4][4]cent[3]*indexartotindexforce*clothObject*sim_parms*coll_parms*point_cache*x*xnew*xold*current_xnew*current_x*current_v*mfacesnumvertsnumfacesabsorptiontime*bvhtreeoperationvertextotinfluencegridsizeneedbind*bindweights*bindcostotcagevert*dyngrid*dyninfluences*dynverts*pad2dyngridsizedyncellmin[3]dyncellwidthbindmat[4][4]*psys*dmtotdmverttotdmedgetotdmfacepsysrt[2]*facepavgroupprotect*fss*target*auxTargetvgroup_name[32]keepDistshrinkTypeshrinkOptsprojAxissubsurfLevels*originfactorlimit[2]originOptspntswopntsuopntsvopntswtypeutypevtypewfufvfwdudvdw*defvec[8][3]partypepar1par2par3parsubstr[32]*track*proxy*proxy_group*proxy_from*action*poselib*poseconstraintChannelsdefbasemodifiersdloc[3]orig[3]dsize[3]drot[3]obmat[4][4]constinv[4][4]laycolbitstransflagipoflagtrackflagupflagnlaflagprotectflagipowinscaflagscavisflagboundtypedupondupoffdupstadupendsfctimemassdampinginertiaformfactorrdampingsizefacmargindtdtxactcolempty_drawtypepad1[3]empty_drawsizedupfacescapropsensorscontrollersactuatorsbbsize[3]actdefgameflaggameflag2*bsoftsoftflaganisotropicFriction[3]constraintsnlastripshooksparticlesystem*pd*soft*dup_groupfluidsimFlagrestrictflagshapenrshapeflagrecalcobody_type*fluidsimSettings*derivedDeform*derivedFinallastDataMaskstateinit_stategpulampcurindexactivedeflectforcefieldpdef_damppdef_rdamppdef_permpdef_frictpdef_rfrictf_strengthf_powerf_distf_dampmaxdistmindistmaxradminradf_power_rpdef_sbdamppdef_sbiftpdef_sboftclump_facclump_powkink_freqkink_shapekink_ampfree_endtex_nablatex_modekinkkink_axisrt2*rngf_noisesimframestartframeendframeeditframelinStiffangStiffvolumeviterationspiterationsditerationsciterationskSRHR_CLkSKHR_CLkSSHR_CLkSR_SPLT_CLkSK_SPLT_CLkSS_SPLT_CLkVCFkDPkDGkLFkPRkVCkDFkMTkCHRkKHRkSHRkAHRcollisionflagsnumclusteriterations*particlestotpointtotspring*bpoint*bspringnodemassgravmediafrictrklimitphysics_speedgoalspringgoalfrictmingoalmaxgoaldefgoalvertgroupfuzzynessinspringinfrictefraintervallocalsolverflags**keystotpointkeysecondspringcolballballdampballstiffsbc_modeaeroedgeminloopsmaxloopschokesolver_IDplasticspringpreload*scratchshearstiffinpush*pointcacheshow_advancedoptionsresolutionxyzpreviewresxyzrealsizeguiDisplayModerenderDisplayModeviscosityValueviscosityModeviscosityExponentgravxgravygravzanimStartanimEndgstarmaxRefineiniVelxiniVelyiniVelz*orgMesh*meshSurface*meshBBsurfdataPath[240]bbStart[3]bbSize[3]typeFlagsdomainNovecgenvolumeInitTypepartSlipValuegenerateTracersgenerateParticlessurfaceSmoothingsurfaceSubdivsparticleInfSizeparticleInfAlphafarFieldSize*meshSurfNormalscpsTimeStartcpsTimeEndcpsQualityattractforceStrengthattractforceRadiusvelocityforceStrengthvelocityforceRadiuslastgoodframemistypehorrhorghorbhorkzenrzengzenbzenkambkfastcolexposureexprangelinfaclogfacgravityactivityBoxRadiusskytypephysicsEnginemisimiststamistdistmisthistarrstargstarbstarkstarsizestarmindiststardiststarcolnoisedofstadofenddofmindofmaxaodistaodistfacaoenergyaobiasaomodeaosampaomixaocolorao_adapt_threshao_adapt_speed_facao_approx_errorao_approx_correctionao_samp_methodao_gather_methodao_approx_passes*aosphere*aotableshemiresmaxiterdrawtypesubshootpsubshootenodelimmaxsublamppamapamielmaelmimaxnodeconvergenceradfacgammaselcolsxsy*lpFormat*lpParmscbFormatcbParmsfccTypefccHandlerdwKeyFrameEverydwQualitydwBytesPerSeconddwFlagsdwInterleaveEveryavicodecname[128]*cdParms*padcdSizeqtcodecname[128]codecaudio_codecvideo_bitrateaudio_bitrategop_sizerc_min_raterc_max_raterc_buffer_sizemux_packet_sizemux_ratemixratemain*mat_override*light_overridelay_zmasklayflagpassflagpass_xor*avicodecdata*qtcodecdataffcodecdatacfrapsfrapefraimagesframaptothreadsframelenblurfacedgeRedgeGedgeBfullscreenxplayyplayfreqplayattribrt1stereomodedimensionspresetmaximsizexschyschxpartsypartswinposplanesimtypesubimtypequalityrpadrpad1rpad2scemoderendererocresalphamodeosafrs_secedgeintsafetyborderdisprectlayersactlayxaspyaspfrs_sec_basegausspostmulpostgammaposthuepostsatdither_intensitybake_osabake_filterbake_modebake_flagbake_normal_spacebake_quad_splitbake_maxdistbake_biasdistbake_padGIqualityGIcacheGImethodGIphotonsGIdirectYF_AAYFexportxmlYF_nobumpYF_clamprgbyfpad1GIdepthGIcausdepthGIpixelspersampleGIphotoncountGImixphotonsGIphotonradiusYF_raydepthYF_AApassesYF_AAsamplesyfpad2GIshadowqualityGIrefinementGIpowerGIindirpowerYF_gammaYF_exposureYF_raybiasYF_AApixelsizeYF_AAthresholdbackbuf[160]pic[160]stampstamp_font_idstamp_udata[160]fg_stamp[4]bg_stamp[4]simplify_subsurfsimplify_shadowsamplessimplify_particlessimplify_aossscineonwhitecineonblackcineongammaparticle_percsubsurf_maxshadbufsample_maxao_errorcol[3]framename[64]*brushtoolstepinverttotrekeytotaddkeybrushtypebrush[7]emitterdistdraw_timedname[36]mat[3][3]cornertypeeditbutflagjointrilimitdegrturnextr_offsdoublimitsegmentsringsverticesunwrapperuvcalc_radiusuvcalc_cubesizeuvcalc_mapdiruvcalc_mapalignuvcalc_flagautoik_chainlenimapaintparticleselect_threshclean_threshretopo_moderetopo_paint_toolline_divellipse_divretopo_hotspotmultires_subdiv_typeskgen_resolutionskgen_threshold_internalskgen_threshold_externalskgen_length_ratioskgen_length_limitskgen_angle_limitskgen_correlation_limitskgen_symmetry_limitskgen_optionsskgen_postproskgen_postpro_passesskgen_subdivisions[3]edge_modepad3[4]dirview*session*cumapdrawbrushsmoothbrushpinchbrushinflatebrushgrabbrushlayerbrushflattenbrushpivot[3]brush_typetexnrtexrepttexfadetexsepaveragingtablet_sizetablet_strengthsymmrakeaxislock*camera*world*setbase*basactcursor[3]twcent[3]twmin[3]twmax[3]editbutsizeselectmodeproportionalprop_modeautomergepad5pad6autokey_mode*ed*radioframing*toolsettingsaudiotransform_spacesjumpframesnap_modesnap_flagsnap_target*theDagdagisvaliddagflagssculptdataframe_stepzoomblendximyimspacetypeblockscale*areablockhandler[8]viewmat[4][4]viewinv[4][4]persmat[4][4]persinv[4][4]winmat1[4][4]viewmat1[4][4]viewquat[4]zfaclay_usedpersp*ob_centre*bgpic*localvd*ri*retopo_view_data*depthsob_centre_bone[32]localviewlayactscenelockaroundcamzoompivot_lastgridgridviewpixsizenearfarcamdxcamdygridlinesviewbutgridflagmodeselecttwtypetwmodetwflagtwdrawflagtwmat[4][4]clip[4][4]*clipbbafterdrawzbufxrayflag2gridsubdivkeyflagsndofmodendoffilter*properties_storage*gpdlviewquat[4]lpersplviewverthormaskmin[2]max[2]minzoommaxzoomscrollkeeptotkeepaspectkeepzoomoldwinxoldwinycursor[2]rowbutv2d*editipoipokeyactname[32]constname[32]bonename[32]totipopinbutofschannellockmedian[3]cursenscuractaligntabomainbmainbo*lockpointexfromshowgroupmodeltypescriptblockre_alignoldkeypresstab[7]chanshownzebra*filelisttotfiletitle[24]dir[240]file[80]ofssortmaxnamelencollumsf_fpfp_str[8]*libfiledataretvalmenuact(*returnfunc)()(*returnfunc_event)()(*returnfunc_args)()*arg1*arg2*menup*pupmenuoopsvisiflagtree*treestoresearch_string[32]search_tsesearch_flagsdo_outlinevisstoreflagdeps_flagsimanrcurtileimtypenrdt_uvstickydt_uvstretchpad[5]centxcentyautosnap*texttopviewlinesfont_idlheightleftshowlinenrstabnumbercurrtab_setshowsyntaxoverwritepix_per_linetxtscrolltxtbarwordwrapdoplugins*py_draw*py_event*py_button*py_browsercallback*py_globaldictlastspacescriptname[256]scriptarg[256]*script*but_refsredraws*idaspect*curfont*edittreetreetype*filesactive_filenumtilesxnumtilesyselstateviewrectbookmarkrectscrollposscrollheightscrollareaactive_bookmarkprv_wprv_h*imgoutline[4]neutral[4]action[4]setting[4]setting1[4]setting2[4]num[4]textfield[4]textfield_hi[4]popup[4]text[4]text_hi[4]menu_back[4]menu_item[4]menu_hilite[4]menu_text[4]menu_text_hi[4]but_drawtypeiconfile[80]back[4]header[4]panel[4]shade1[4]shade2[4]hilite[4]grid[4]wire[4]select[4]lamp[4]active[4]group[4]group_active[4]transform[4]vertex[4]vertex_select[4]edge[4]edge_select[4]edge_seam[4]edge_sharp[4]edge_facesel[4]face[4]face_select[4]face_dot[4]normal[4]bone_solid[4]bone_pose[4]strip[4]strip_select[4]cframe[4]vertex_sizefacedot_sizebpad[2]syntaxl[4]syntaxn[4]syntaxb[4]syntaxv[4]syntaxc[4]movie[4]image[4]scene[4]audio[4]effect[4]plugin[4]transition[4]meta[4]editmesh_active[4]handle_vertex[4]handle_vertex_select[4]handle_vertex_sizehpad[7]solid[4]tuitbutstv3dtfiletipotinfotsndtacttnlatseqtimatimaseltexttoopsttimetnodetarm[20]bpad[4]bpad1[4]spec[4]dupflagsavetimetempdir[160]fontdir[160]renderdir[160]textudir[160]plugtexdir[160]plugseqdir[160]pythondir[160]sounddir[160]yfexportdir[160]versionsvrmlflaggameflagswheellinescrolluiflaglanguageuserprefviewzoomconsole_bufferconsole_outmixbufsizefontsizeencodingtransoptsmenuthreshold1menuthreshold2fontname[256]themesundostepsundomemorygp_manhattendistgp_euclideandistgp_erasergp_settingstb_leftmousetb_rightmouselight[3]tw_hotspottw_flagtw_handlesizetw_sizetextimeouttexcollectratememcachelimitprefetchframesframeserverportpad_rot_angleobcenter_diarvisizervibrightrecent_filessmooth_viewtxglreslimitndof_panndof_rotatecurssizepad[8]versemaster[160]verseuser[160]glalphaclipautokey_flagcoba_weightvertbaseedgebaseareabase*sceneendxendysizexsizeyscenenrscreennrfullmainwinwinakthandler[8]*newvvec*v1*v2panelname[64]tabname[64]drawname[64]ofsxofsycontrolsnapold_ofsxold_ofsysortcounter*paneltab*v3*v4*fullwinmat[4][4]headrctwinrctheadwinwinheadertypebutspacetypewinxwinyhead_swaphead_equalwin_swapwin_equalheadbutlenheadbutofscursorspacedatauiblockspanelssubvstr[4]subversionpadsminversionminsubversiondisplaymode*curscreen*curscenefileflagsglobalfname[80]*ibuf*ibuf_comp*se1*se2*se3nrbottomrightxofsyofslift[3]gamma[3]gain[3]saturationdir[160]donestartstillendstill*stripdataorxory*crop*transform*color_balance*tstripdata*tstripdata_startstill*tstripdata_endstill*ibuf_startstill*ibuf_endstill*instance_private_data**current_private_data*tmpstartofsendofsmachinestartdispenddispmulhandsizeanim_preseek*stripfacf0facf1*seq1*seq2*seq3seqbase*sound*hdaudiolevelpancurposstrobe*effectdataanim_startofsanim_endofsblend_modeblend_opacity*oldbasep*parseq*seqbasepmetastackedgeWidthforwardwipetypefMinifClampfBoostdDistdQualitybNoCompScalexIniScaleyIniScalexFinScaleyFinxInixFinyIniyFinrotInirotFininterpolation*frameMapglobalSpeedlastValidFramebuttypeuserjitstatotpartnormfacobfacrandfactexfacrandlifeforce[3]vectsizemaxlendefvec[3]mult[4]life[4]child[4]mat[4]texmapcurmultstaticstepomattimetexspeedtexflag2negvertgroup_vvgroupname[32]vgroupname_v[32]*keysminfacusedusedelemdxdylinkotypeold*poin*oldpoinresetdistlastval*makeyqualqual2targetName[32]toggleName[32]value[32]maxvalue[32]delaydurationmaterialName[32]damptimerpropname[32]matname[32]axisflag*fromObjectsubject[32]body[32]pulsefreqtotlinks**linksjoyindexaxisfbuttonhathatfprecisionstr[128]*mynewinputstotslinks**slinksvalostate_mask*actframeProp[32]blendinpriorityend_resetstrideaxisstridelengthsndnrpad1[2]makecopycopymadepad2[1]track*melinVelocity[3]angVelocity[3]localflagdyn_operationforceloc[3]forcerot[3]linearvelocity[3]angularvelocity[3]butstabutendminmaxvisifacrotdampminloc[3]maxloc[3]minrot[3]maxrot[3]matprop[32]distributionint_arg_1int_arg_2float_arg_1float_arg_2toPropName[32]*toObjectbodyTypefilename[64]loadaniname[64]int_argfloat_arggoaccellerationmaxspeedmaxrotspeedmaxtiltspeedtiltdampspeeddamp*sample*stream*newpackedfile*snd_soundpanningattenuationpitchmin_gainmax_gaindistancestreamlenchannelshighpriopad[10]gaindopplerfactordopplervelocitynumsoundsblendernumsoundsgameengine*lamprengobjectdupli_ofs[3]childbaserollhead[3]tail[3]bone_mat[3][3]arm_head[3]arm_tail[3]arm_mat[4][4]xwidthzwidthease1ease2rad_headrad_tailbonebasechainbasepathflaglayer_protectedghostepghostsizeghosttypepathsizeghostsfghostefpathsfpathefpathbcpathacconstflagikflagselectflagagrp_index*bone*childiktree*b_bone_mats*dual_quat*b_bone_dual_quatschan_mat[4][4]pose_mat[4][4]pose_head[3]pose_tail[3]limitmin[3]limitmax[3]stiffness[3]ikstretch*customchanbaseproxy_layerstride_offset[3]cyclic_offset[3]agroupsactive_groupcustomColcs*grpreserved1groupsactive_markeractnractwidthtimeslidename[30]ownspacetarspaceenforceheadtail*tarsubtarget[32]matrix[4][4]space*proptarnumtargetsiterationsrootbonemax_rootbone*poletarpolesubtarget[32]poleangleorientweightgrabtarget[3]reserved2minmaxflagstuckcache[3]lockflagfollowflagvolmodeplaneorglengthbulgepivXpivYpivZaxXaxYaxZminLimit[6]maxLimit[6]extraFzinvmat[4][4]fromtomap[3]expofrom_min[3]from_max[3]to_min[3]to_max[3]zminzmaxchannel[32]no_rot_axisstride_axiscurmodactstartactendactoffsstridelenblendoutstridechannel[32]offs_bone[32]hasinputhasoutputdatatypesockettype*new_socknslimitstack_indexinternstack_index_extlocxlocyown_indexto_index*tosock*link*new_nodeusername[32]lastyoutputs*storageminiwidthcustom1custom2need_execexectotrbutrprvr*typeinfo*fromnode*tonode*fromsocknodeslinks*stack*threadstackinitstacksizecur_indexalltypes*owntype*selin*selout(*timecursor)()(*stats_draw)()(*test_break)()cyclicmoviesamplesminspeedpercentxpercentybokehcurvedimage_in_widthimage_in_heightcenter_xcenter_yspiniterwrapsigma_colorsigma_spacehuesatt1t2t3fstrengthfalphakey[4]x1x2y1y2colname[32]bktyperotationpreviewgamcono_zbuffstopmaxblurbthresh*dict*nodeangle_ofscolmodmixthresholdfademcjitprojfitshortymintablemaxtableext_in[2]ext_out[2]*curve*table*premultablecurrcliprcm[4]black[3]white[3]bwmul[3]sample[3]offset[2]innerradiusratergb[3]cloneactive_rnd*layerstotlayermaxlayertotsize*pooleditflagvel[3]rot[4]ave[3]numparentpa[4]w[4]fuv[4]foffsetrand[3]*stick_obprev_state*hairi_rot[4]r_rot[4]r_ave[3]r_ve[3]dietimebanksizemulnum_dmcachebpialiveloopdistrphystyperotmodeavemodereacteventdrawdraw_asdraw_sizechildtypedraw_stepren_stephair_stepkeys_stepadapt_angleadapt_pixrotfromintegratornbetweenboidneighboursbb_alignbb_uv_splitbb_animbb_split_offsetbb_tiltbb_rand_tiltbb_offset[2]simplify_flagsimplify_refsizesimplify_ratesimplify_transitionsimplify_viewporttimetweakjitfackeyed_timeeff_hairgrid_respartfactanfactanphasereactfacavefacphasefacrandrotfacrandphasefacrandsizereactshapeacc[3]dragfacbrownfacdampfacabslengthrandlengthchild_nbrren_child_nbrparentschildsizechildrandsizechildradchildflatchildspreadclumpfacclumppowrough1rough1_sizerough2rough2_sizerough2_thresrough_endrough_end_shapebranch_thresdraw_line[2]max_velmax_lat_accmax_tan_accaverage_velbankingmax_bankgroundzboidfac[8]boidrule[8]*eff_group*dup_ob*bb_ob*pd2*part*edit**pathcache**childcachepathcachebufschildcachebufs*target_ob*keyed_ob*latticeeffectorsreacteventstotchildtotcachedtotchildcachetarget_psyskeyed_psystotkeyedbakespacebb_uvname[3][32]vgroup[12]vg_negrt3*renderdata*cacheCdisCvi[3]structuralbendingmax_bendmax_structmax_shearavg_spring_lentimescaleeff_force_scaleeff_wind_scalesim_time_oldstepsPerFrameprerollmaxspringlensolver_typevgroup_bendvgroup_massvgroup_structpresets*collision_listepsilonself_frictionselfepsilonself_loop_countloop_countpressure*pointstotpointsthicknessstrokesframenum*actframegstepinfo[128]sbuffer_sizesbuffer_sflag*sbufferTYPE_charucharshortushortintlongulongfloatdoublevoidLinkLinkDataListBasevec2svec2ivec2fvec2dvec3ivec3fvec3dvec4ivec4fvec4drctirctfIDPropertyDataIDPropertyIDLibraryFileDataPreviewImageIpoDriverObjectIpoCurveBPointBezTripleIpoKeyBlockKeyScriptLinkTextLineTextMarkerTextPackedFileCameraImageUserImageGPUTextureanimRenderResultMTexTexPluginTexCBDataColorBandEnvMapImBufTexMappingLampCurveMappingWaveMaterialbNodeTreeGroupVFontVFontDataMetaElemBoundBoxMetaBallNurbCharInfoTextBoxCurvePathMeshMFaceMTFaceTFaceMVertMEdgeMDeformVertMColMStickyMSelectCustomDataMultiresPartialVisibilityMDeformWeightMTexPolyMLoopUVMLoopColMFloatPropertyMIntPropertyMStringPropertyOrigSpaceFaceMultiresColMultiresColFaceMultiresFaceMultiresEdgeMultiresLevelMultiresMapNodeModifierDataSubsurfModifierDataLatticeModifierDataCurveModifierDataBuildModifierDataMaskModifierDataArrayModifierDataMirrorModifierDataEdgeSplitModifierDataBevelModifierDataBMeshModifierDataDisplaceModifierDataUVProjectModifierDataDecimateModifierDataSmoothModifierDataCastModifierDataWaveModifierDataArmatureModifierDataHookModifierDataSoftbodyModifierDataClothModifierDataClothClothSimSettingsClothCollSettingsPointCacheCollisionModifierDataBVHTreeBooleanModifierDataMDefInfluenceMDefCellMeshDeformModifierDataParticleSystemModifierDataParticleSystemDerivedMeshParticleInstanceModifierDataExplodeModifierDataFluidsimModifierDataFluidsimSettingsShrinkwrapModifierDataSimpleDeformModifierDataLatticebDeformGroupbActionbPoseBulletSoftBodyPartDeflectSoftBodyObHookRNGSBVertexBodyPointBodySpringSBScratchWorldRadioBaseAviCodecDataQuicktimeCodecDataFFMpegCodecDataAudioDataSceneRenderLayerRenderDataRenderProfileGameFramingTimeMarkerImagePaintSettingsBrushParticleBrushDataParticleEditSettingsTransformOrientationToolSettingsBrushDataSculptDataSculptSessionSceneDagForestBGpicView3DSpaceLinkScrAreaRenderInfoRetopoViewDataViewDepthsbGPdataView2DSpaceInfoSpaceIpoSpaceButsSpaceSeqSpaceFiledirentryBlendHandleSpaceOopsTreeStoreTreeStoreElemSpaceImageSpaceNlaSpaceTextScriptSpaceScriptSpaceTimeSpaceNodeSpaceImaSelFileListThemeUIThemeSpaceThemeWireColorbThemeSolidLightUserDefbScreenScrVertScrEdgePanelFileGlobalStripElemTStripElemStripCropStripTransformStripColorBalanceStripProxyStripPluginSeqSequencebSoundhdaudioMetaStackEditingWipeVarsGlowVarsTransformVarsSolidColorVarsSpeedControlVarsEffectBuildEffPartEffParticleWaveEffOopsbPropertybNearSensorbMouseSensorbTouchSensorbKeyboardSensorbPropertySensorbActuatorSensorbDelaySensorbCollisionSensorbRadarSensorbRandomSensorbRaySensorbMessageSensorbSensorbControllerbJoystickSensorbExpressionContbPythonContbActuatorbAddObjectActuatorbActionActuatorbSoundActuatorbCDActuatorbEditObjectActuatorbSceneActuatorbPropertyActuatorbObjectActuatorbIpoActuatorbCameraActuatorbConstraintActuatorbGroupActuatorbRandomActuatorbMessageActuatorbGameActuatorbVisibilityActuatorbTwoDFilterActuatorbParentActuatorbStateActuatorFreeCamerabSamplebSoundListenerSpaceSoundGroupObjectBonebArmaturebPoseChannelbActionGroupbActionChannelSpaceActionbConstraintChannelbConstraintbConstraintTargetbPythonConstraintbKinematicConstraintbTrackToConstraintbRotateLikeConstraintbLocateLikeConstraintbMinMaxConstraintbSizeLikeConstraintbActionConstraintbLockTrackConstraintbFollowPathConstraintbStretchToConstraintbRigidBodyJointConstraintbClampToConstraintbChildOfConstraintbTransformConstraintbLocLimitConstraintbRotLimitConstraintbSizeLimitConstraintbDistLimitConstraintbActionModifierbActionStripbNodeStackbNodeSocketbNodeLinkbNodebNodePreviewbNodeTypeNodeImageAnimNodeBlurDataNodeDBlurDataNodeBilateralBlurDataNodeHueSatNodeImageFileNodeChromaNodeTwoXYsNodeTwoFloatsNodeGeometryNodeVertexColNodeDefocusNodeScriptDictNodeGlareNodeTonemapNodeLensDistCurveMapPointCurveMapBrushCloneCustomDataLayerHairKeyParticleKeyChildParticleParticleDataParticleSettingsParticleEditParticleCacheKeyLinkNodebGPDspointbGPDstrokebGPDframebGPDlayerTLEN   L4( H\$8Tpx(x T8l|LDlh88,< L   @ 84DX`D`t@<l<<\hd4Dd@L@@@<lht(T8pd(4H8P HP`<$$X P$88 x P4 088,@0,Hh(H,(lDLP<< \PLhT`<8l (DtH@,@t<h4,,D,@,4` l\4<$x( (@   ,<8HSTRC6                     !"#$%&'()*+, -./0!!!"1#234./56789  :;<=>$ ?@.AB%%%%C=/DEF GHIJ& %KLM= N$OPQR'STUV%(((WXY) ))Z[\+]^_*`]a b(c(def ghij kl+mn]% ,opqrstuvwxyz{|$O'} ~- . " /01%++ 2 394   %5C@6$@57 .8qr35-$O.4679 -:P     ;Fqr !"#$%&'()*++,-./0123456789:;<=>?@ABCDEFGH2I$O'}<$O=JKLMNOPQRSTUVWXYZ[\]^_`abcdefghijklmnopqrs tuvwxyz{|}~+<662I>$O?F'} @%A+BBBCDC  $O=# "%EEE"1#2F%FGH9C     $OI&= FbC  @ @ @ @%GFFJ'C $O&=KLMNOPQRJ S!T"T#T$6%&'()%*+,-U.V/ M 0123 45K6789%:O67;<W=PW>?N@A<QX.03 45YBZ%RCSDL1.03 45[E\F]G^1_`_2aHIJbKIcccaL`MbNO P QdR6&%%NSU TNSUVWXYZ[T"T$\]V^_K`Oa&%6%eee bfecdTe] f ggec hec hiiec[jkljec mH k ec n o p qrsjtuv]wlecxy zmec{]n ec|}%]~oec%p ec3 %q ec .]%recsectec muec 3 %+vecF w ec xecyecz{|}~ecNNNNNNK%ec %ec %6ec9ec -ecec} ec  i ec  x%F%"$O&PC% m &    $OIC      =      '} ! " # $%D&2'()*+ , - . /01?23456*789:;<=>F ? &@A$BCDEFGHIJKLMNOPQRSTUVWXYZ[\]^_3`a%}bcdefghijklmnopqrstuvwxyz{|}~,%Q}0JJJ$ONB +PRQ  +  $O2I'}     !"#$%&'(%) * +,F- ./012]3456789 =:?;<=%>?x@ABCDEFGHIJKLMNOPQRS_TUmVWXYZ[\]^_`abc defghijkl mn%opqrstuvwxyz{|}~ +F+Fm*mJ2I;+]J+ .      > '} g <% .-m !"K#$%&'()*+,-./0  123456789:;<=+s>?@ABCDEFGHIJKLMNCO PQ3RSTUVW XYZ[\ $@]^_`abcdefghij;i#$%&#$%&#$%&kFl m n$OPopqrstuA.vw$#$%4&xyz{l|s} ~ %+#$%&l|%Y!#$%&+F     #$%&l s9 ~ #$%&l.-;  vsY #$%&vl#$%&*]      ] #$%]+ #$%l#$%&lP >>%Y*#$%&l b%+     86     _ !"#$%&'%()*+,-./0123456789:%2;B<=>?@ABCDEFGHIJKLMNOPQRSTUVW XYZ[\]^_`abcdefghijklmnopqrst%uvwxy6z { | }~% k%A4#'}    [  88%988      -  [$O~0  %    %9p   %  ]j 99-\Ql% !"#$S%&'()?*+E, -. / 01% 2 345%+F=6%789:;%<=%>?%@A Fpxl>BC +D EFG0HIJ+F K -% LxMNOPQR*STJ0UF KVWX% - Y\Z[\]^_ `\abcd`\eh  -Jfgh%ij%~  < -  0klmn  \Z+@op  -qrxs   t%uvwxy \@op?lz{|}~B F+FG\_*_ -_ S0  - t% ++ $Oh]#$%l `vF - %? & j  " ,&       % $O    g% #$%&l sv!!!$O" "" %$O# ## %$*  %  & ]%' ( ) +F* + [\qr%Y, - . /  %+F0 S1 %2      3    S4    S5    S6  %7 77 -888 $OY [\[ 9qr  !::::"9#$%&'+()*+:,;-<<<<./0% T 1 2()3456789:=>;;;;<<<=:>:,> ? @9A BCDE F>G:H:I J KL?MN%@OPDQRST%UVA WXpYZ[%B\]Z%C^_D]^_.E`abcdeFfghiGHjIJ klmnOopqrK s tL _ZpumJvwxyM7Ez{N|}~%OP OOO; @PQ.X%  mX+%2IQRA_ TR% S@%T@UV T=TST)m%Q_Wp " ]^\9mjYWX  ?2?   $O0 %W VUX Y Y 1    Cl   9   *      }{"Z    ! " # $ % & ' ( ) * + ], - . / 0 1 2 %F|Z3 4 5 6 ]7 8 [9 \\\[: ; < ]]] = > ^ ^^ ]? < @ ^A  mB C D ENDB