BLENDER_V243REND dSceneGLOB  0Ӗ !SRx FSR1-AnimationP""@&&@@ kCdl"DATAPDATAP"DATA l"DATA  @lDATA @  DATA   @lDATA ! DATA!!@ lDATA!@!!DATA!!!@DATA!"!DATA"!lDATA"@"DATA"""@P DATA"#" @ DATA##@" DATA#@##!DATA###@ !DATA#$# @!@DATA$$@# !@DATA$@$$ !DATA$$$@!!DATA$%$!@!DATA%%@$ !DATA%@%% @ DATA%%%@P!DATA%&% @!DATA&&@% "DATA&@&& "DATA&&@!"DATA&3P!" lllmO1P2P'0@DATA'(Link and MaterialsEditing>DATA()'MeshEditingF>DATA)*(Anim settingsObject>DATA*,)DrawObjectF>DATA,-*ConstraintsObject>DATA-. ,EffectsObjectDATA. /0-HooksObjectF>*DATA/00@. Particle InteractionObject>,DATA0@/0SoftbodyObject>,DATA1Pu2P?333D@ChD6ChCB(DC??zmDATAh2Pw1P?333/9DATA34& !l "l #l""mDATA493 @ !!@=9+|=vo?^ 856DATA56Transform PropertiesView3d>DATA653D Viewport propertiesView3d>"DATA^ p8?333????????=9+|=vo?A;A?=9+|=vo??????A; B ??=C  DATAh8w^ ?333/9DATA9@@4!@!! ??Plll;>::DATA:Transform PropertiesIpo!>DATA(;t<?333 Cz?Cz@kk<# <# Fj`Dz OBCz?DATA<x>;?333 @AzAAQBAQA @CC<# @DATAx>{b < ?333 c6 >jDATAb p>>?333 ??? ????A ???PAA ?O!?jG}CBH?A  B ?<# C DATAh>wb ?333 /9DATA@@9! @ "lll mC`E0A@BPDATAA@BPLink and MaterialsEditing>DATABPA@MeshEditingF>DATAC`D0 ?333&CzCBHCmm?CFC=A DATAD0uE0C`?333&D#ChD`CgJpChCB(DC??zDATAhE0wD0?333&/9SRxFӖ SR2-LogicBricksdelliG`IIM`MӐ CDATAG`GDATAGGG`DATAGH GDATAH H`GDATAH`HH DATAHHH`DATAHI HDATAI I`HDATAI`II DATAII`DATAIJ GGDATAJ J`IH`HDATAJ`JJ GHDATAJJJ`GI DATAJK JHI DATAK K`JH`HDATAK`KK G`H DATAKKK`I`IDATAKL KI IDATAL L`KHI`DATAL`LL G`H`DATALLL`H HDATALM LHIDATAM M`LH`I`DATAM`M HI DATAMNHGGI ?DgPDATANӇMG`H`HH ?@POӆӆOӅDATAOPPreviewLamp>DATAPQOLampLampF>DATAQRPSpotLamp>DATARSQTexture and InputLamp>DATASTRMap ToLamp>RDATATVSPreviewMaterial>DATAVWTMaterialMaterial>DATAWX VPreviewWorld>DATAX Y0WWorldWorldF>DATAY0Z@X Mist Stars PhysicsWorld>DATAZ@[PY0Texture and InputWorld>DATA[P\`Z@Map ToWorld>Z@DATA\`]p[POutputRender>DATA]p^\`RenderRenderF>DATA^_]pAnimRender>DATA_`^FormatRender>DATA`a_Link and MaterialsEditing>DATAab`MeshEditingF>DATAbcaMesh ToolsEditing>DATAcdbMesh Tools 1Editing>DATAdecCameraEditingF>DATAegdShadersMaterial>DATAgheTextureMaterial>DATAhi gAnim settingsObject>DATAi j0hDrawObject>DATAj0k@i ConstraintsObject>DATAk@lPj0ScriptlinksScript>DATAlPm`k@EffectsObjectj0DATAm`nplPMap InputMaterial>gDATAnpom`Map ToMaterial>gDATAopnpAnimAnim>DATApqoSoundSound>DATAqrpListenerSoundF>DATArsqSequencerSound>DATAstrHooksObjectF>i DATAtusParticle InteractionObject>j0DATAuvtShadow and SpotLamp>DATAvxuMist / Stars / PhysicsWorld>DATAxyvAmb OccWorld>vDATAyz xRender LayersRender>\`DATAz {0yLinks and PipelineMaterialF>DATA{0|@z RampsMaterial>VDATA|@}P{0Mirror TranspMaterial>eDATA}P~`|@ModifiersEditing>DATA~`p}PShapesEditing>}PDATApӀ~`PaintEditing>DATAӀӁpTexture faceEditing>DATAӁӂӀUV CalculationEditing>ӀDATAӂӃӁRadio RenderRadio>DATAӃӄӂRadio ToolRadioF>DATAӄӅӃObject and LinksObjectF>DATAӅӄPreviewTexture>DATAӆuDCdDz9*(CzpCB(EC??HDATAӇӐNI`II H??Df<-AMH8f ӏӈӉDATAӈӉTransform PropertiesView3d>"DATAӉӈTransform PropertiesIpo>"DATAf pӋ?333?244@?;/6Sb!~??42?4@@!|??2gA}9bA{A?j3j)*2?(V23(BҤI֘R:®,AJR@(??Df<-AMH?244@?;/6Sb!~??55KdVBQ Ai@ B ??;Rn=C´;BCwm!k"@ ???? DATAxӋ{Ӌf ?333c2 =VDATA(ӋtӌӋ?333Cz??Cz@<# <# Fj`Dz bjectOB?Cz?DATAӌyӎӋ?333DDl@@v~@/yL@>VB|BDATAӎuӏӌ?333DCdC8Dnf CCB(DC??zDATAhӏwӎ?333Replace ImageICTURES/Users/chris/Art_Videogame/BlenderBuilt/TheEngineRoom/terrain/wallBits01.jpgstv2.blend cDATAӐӇH`HII`<<Qo?j ӕӑӑDATAӑTransform PropertiesView3di>"DATAj pӒ?333??@?@+0@bf????%bf@A+0?o<ߢ=<Q!DV˾igi?Bz%TB52yybg@A+0?<<Qo???@?@+0@bf??Bz%U?  B ?A >98=C<~;(@bf+0k"@ ???? DATA(ӒtӔj ?333?A ??fffCz?<# <# Fj`Dz bjectLA?A ?DATAӔuӕӒ?333DCdC8Dnf CCB(DC??zDATAhӕwӔ?333Load Library.0CTURES/Users/chris/Art_Videogame/treee.blend/Scene/ineRoom/../SceneSwapTestv2.blend/ject/SceneeneSwapTestv2.blendlendd$SRxӖ0FSR2-Modelling-Model ӗ0әpәӝ0ӝpp C|DATAӗ0ӗpDATAӗpӗӗ0|DATAӗӗӗp|DATAӗӘ0ӗDATAӘ0ӘpӗDATAӘpӘӘ0DATAӘӘӘpbDATAӘә0ӘbDATAә0әpӘDATAәpә0bDATAәәӗpӗDATAәӚ0әӘ0ӘpDATAӚ0ӚpәӗpӘDATAӚpӚӚ0ӗӘDATAӚӚӚpӘӘDATAӚӛ0ӚӘ0ӘDATAӛ0ӛpӚӗ0ӗDATAӛpӛӛ0ә0әpDATAӛӛӛpӘәpDATAӛӜ0ӛӘpә0DATAӜ0Ӝpӛӗ0Ә0DATAӜpӜӜ0ӗӘpDATAӜӜӜpӘәpDATAӜӝ0ӜӘ0ә0DATAӝ0ӜӘpӘDATAӝpӞpӘӗpӗӘ?DgPc|c}||fPfPDATAӞpӝpӗ0Ә0Әpӗ?@POjPmӟpְDATAӟpӠPreviewLamp>DATAӠӡӟpLampLampF>DATAӡӢӠSpotLamp>DATAӢӣӡTexture and InputLamp>DATAӣӤӢMap ToLamp>ӢDATAӤӥӣPreviewMaterial>DATAӥӦӤMaterialMaterial>DATAӦӧӥPreviewWorld>DATAӧөӦWorldWorldF>DATAөӪӧMist Stars PhysicsWorld>DATAӪӫ өTexture and InputWorld>DATAӫ Ӭ0ӪMap ToWorld>ӪDATAӬ0ӭ@ӫ OutputRender>DATAӭ@ӮPӬ0RenderRenderF>DATAӮPӯ`ӭ@AnimRender>DATAӯ`ӰpӮPFormatRender>DATAӰpӱӯ`Link and MaterialsEditing>DATAӱӲӰpMeshEditingF>DATAӲӳӱMesh ToolsEditing>DATAӳӴӲMesh Tools 1Editing>DATAӴӵӳCameraEditingF>DATAӵӶӴShadersMaterial>DATAӶӷӵTextureMaterial>DATAӷӸӶAnim settingsObject>DATAӸӺӷDrawObject>DATAӺӻӸConstraintsObject>DATAӻӼ ӺScriptlinksScript>DATAӼ ӽ0ӻEffectsObjectӺDATAӽ0Ӿ@Ӽ Map InputMaterial>ӶDATAӾ@ӿPӽ0Map ToMaterial>ӶDATAӿP`Ӿ@AnimAnim>DATA`pӿPSoundSound>DATAp€`ListenerSoundF>DATA€ÐpSequencerSound>DATAÐĠ€HooksObjectF>ӸDATAĠŰÐParticle InteractionObject>ӺDATAŰĠShadow and SpotLamp>DATAŰMist / Stars / PhysicsWorld>DATAAmb OccWorld>DATARender LayersRender>Ӭ0DATALinks and PipelineMaterialF>DATARampsMaterial>ӥDATA Mirror TranspMaterial>ӵDATA 0ModifiersEditing>DATA0@ ShapesEditing> DATA@P0PaintEditing>DATAP`@Texture faceEditing>DATA`pPUV CalculationEditing>PDATApӀ`Radio RenderRadio>DATAӀԐpRadio ToolRadioF>DATAԐՠӀObject and LinksObjectF>DATAՠְԐPreviewTexture>DATAְՠMultiresEditing>DATAuӞpDCd)(D aCaCB(EC??Hh DATApӞpӘ0Әәpә0=Q=2o?aGaF  Z. DATATransform PropertiesView3d>"DATAx{n ?3332 =%'RDATAn pp?333??@?@?!WJٸ??%@??% @?ٸ!@WI?Qo=Qf=2!D=yIz;"?AZ4&̇N3A!9yy;?ٸ!@WI?=Q=2o???@?@?!WJٸ??A!9? B ??= m=C<~;(ٸ?!WJk"@ ???? DATA(ptn ?333>PA%>8?HBBQl@@pZZ<# <# Fj`Dz Tt bjectOB>PA%>8?HDATAyp?333CC?-?րZd?DATAu?333DCdC8Dnf CCB(DC??zDATAhw?333Save AsT FILECTURES/Users/chris/Art_Videogame/BlenderBuilt/Test Files/./yList.blend.blend/Text//../t/trackToNearestEnemy.blendlendlenddNDATApә0әpӘӘp@?;@ 3"DATApTransform PropertiesIpo>"DATAr p?333p?244?;.b6"z??42?4=dz@"?@?;3̴Ao~3d1>̊%SBcgq>- ;Aח@(@?;@ 3,&Z,$l &*2@f? DATAx{0r ?333pl2 =RDATA(0t?333pCz??Cz@<# <# Fj`Dz bjectOB?Cz?DATAy0?333pDDl@@v~@/yL@>VB|BDATAu?333pDCdC8Dnf CCB(DC??zDATAhw?333pLoad LibraryICTURES/Users/chris/Art_Videogame/AeroCrush/templategames/sideScrollTemplate.blend/Object/puffList.blendd.blendate.blend$Y~SRx0!@ӖSR3-Materialodel SingP` kCdl"DATADATAP"DATAPl"DATAPlDATA(DATAPl(DATAPDATAPlDATA(DATAPDATAPDATAPDATADATADATAPPDATAPDATADATAPDATAPDATAPPDATAPDATAPPDATAPDATAPDATADATAPDATAPDATAPPDATAPPDATAPDATAPDATAPPDATAPDATAPDATAPPDATAPDATADATA?@Pl'll' m(P@@DATA OutputRender>DATA 0RenderRenderF>DATA0@ AnimRender>DATA@0FormatRender>DATAP ?333uCzCBHCmm(?CFC=A DATA uv P?333uDCh?DChCB(DC??zmDATAv p  ?333u??? ????A ??@PAA ?j>3cG}CBH?A  B ?<# C DATA x@v ?333u@ARB|@1AlA @CC<# @DATAh@w ?333u/9DATAPPl "l #l""mDATA@G? LJl)l)ClD~ DATAOutputRender>DATARenderRender>DATAAnimRender0>DATAFormatRenderH>DATA PreviewMaterial>DATA 0MaterialMaterial>DATA0@ ShadersMaterial0>DATA@P0TextureMaterialH>DATAP`@Map InputMaterialD>DATA` pPMap ToMaterial`>DATA p `PreviewLamp>DATA   pLampLamp>DATA   Shadow and SpotLamp0>DATA   Texture and InputLampH>DATA  Map ToLampH> DATAuz ?333<CqChCf|CA|QCB(DC??zDATAz p?333<>JH¦?!?ux)>6ibP=?(?L^?az?>J?ux#=H >6i?(? bP?L^AF\A??[4ſ[!@?>Gj>bg>bP>mI4?&kM]L^@0<AAz=>&? x:A¶1Bvj,B@~@G? LJ>JH¦?!?ux)>6ibP=?(?L^?az??@ھ$$AO  B ?=C?h?4(j>'td DATA(tz ?333<Cz A Cz A <# <# Fj`Dz OBDATAhw?333<;SAVE FILE/usr/home/intrr/blender/blend/untitled.blendDATAP=.U=ڬjo?))CDp~ DATA~ p?333ʏ??@?@?4(j>'t?h? ?%@%@ @??% @h4(j't?.Uo=.UP=ڬj ě<94=Va? RAO'{& AWh4(j't?=.U=ڬjo???@?@?4(j>'t?h??AO  B ??=C?h?4(j>'td DATAu~ ?333ʏDCdC9>D,eCCB(DC??zDATA(t?333ʏCz A Cz A <# <# Fj`Dz OBDATAhw?333ʏ SAVE FILE/Users/ton/Desktop/der/blend/untitled.blendDATA`??( LJSS DATA p?333ʔ?L? ?K><?L5T?IZ?r6>d%??N?K<@>?L5T? ξ?IWA9%BA4L??)o+3fͿ C ?^ջ?z>>?A,Ad%? ?:D:<6>{?hhQBNaUoBeLB_[@??( LJ?L? ?K><?L5T?IZ?r6>d%??LΙվAֶEA  B ??=C?h?4(j>'td DATAu ?333ʔDCdC9>D,eCCB(DC??zDATA(t?333ʔCz A Cz A <# <# Fj`Dz OBDATAhw?333ʔ SAVE FILE/Users/ton/Desktop/der/blend/untitled.blendDATA`PP=G=Lo?SS DATA p`?333ʙ???^?4(j(2J????=^4(jA(2J?=G=LoC,= <;?AA=^4(jA(2J?=G=Lo????^?4(j(2J??A  B ??=C^?4(j(2Jd DATA`u` ?333ʙDCdC9>D,eCCB(DC??zDATA(`t`?333ʙCz A Cz A <# <# Fj`Dz OBDATAhw`?333ʙ SAVE FILE/Users/ton/Desktop/der/blend/untitled.blendSRx!@0SR4-Sequence!$$) )`9 5DATA!" DATA" "`!DATA"`"" DATA"""`DATA"# "DATA# #`"DATA#`## DATA###`DATA#$ #\DATA$ $`#\DATA$`$$ \DATA$$`DATA$% " "`DATA% %`$!"DATA%`%% !"DATA%%%`"# DATA%& %"# DATA& &`%" #`DATA&`&& "`#DATA&&&`#`#DATA&' &"#DATA' '`&#`#DATA'`'' #$ DATA'''`# $ DATA'( '#$ DATA( (`'#$`DATA(`(( $ $`DATA(((`#`$DATA() (#$DATA) ($`$DATA)`10!"# "./*`-DATA*`+pOutputRender>DATA+p,*`RenderRenderF>DATA,-+pAnimRender>DATA-,FormatRender>DATA.u/?333uDCh&DChCB(DC??zDATAh/w.?333u/9DATA1020)`#`" "`#DATA20510"#$ # =8>iιo?[  [P 304DATA30v ?333}|CzACzAPPA @FB=A DATA p430?333}|????????=8>iιo?Afff@&D??Afff B ?<# C DATAh4w ?333}|AVE TARGA/t1.blend9DATA5920$`$#$ =8>Ho?]]]]S 67DATA6v ?333 CzACzA1||1A @FB=A DATA p76?333 ????????=8>Ho?Afff@*??Afff B ?<# C DATAh7w ?333 AVE TARGA/t1.blend9DATA95##`$$`=8>o?]]wx8:;`DATA(:t ?333ሜB?B?88<# <# Fj`Dz SQB?DATA p;`:?333ሜ????????=8>o?Afff@ϒ??Afff B ?<# C DATAh;`w ?333ሜOAD FILE/9SC nSCSceneadeInadeOut.0 ]@<JI @QA?Rp &*2@f &*2@f &*2@f=KKPdd??< dddZ@??KK????//backbuf/tmp///ftype@&#@^@&^#D pDATA<a=@+` DATA=@a=<T\ DATA=a==@oOX DATA=a>0=\T DATA>0a>=M1P DATA>a>>0.L DATA>a? >.aH DATA? a?p>.\D DATA?pa??  =@ DATA?a@?p W< DATA@a@`? /8 DATA@`a@@ 4 DATA@aA@` 0 DATAAaAP@, DATAAPaAA( DATAAaAAP$ DATAAaB@APJ DATAB@aBAg DATABaBB@_ DATABaC0B}p DATAC0aCB DATACaCC0\ DATACaD C DATAD aDpC- DATADpaDD T DATADaEDpo DATAEaE`D DATAE`aEE DATAEaFE`f  DATAFaFPEA DATAFPaFF DATAFaFFP  DATAFaG@F! DATAG@aGF"| DATAGaGG@#\U DATAGaH0G$| DATAH0aHG @p DATAHaHH0%qx DATAHaI H&l DATAI aIpH'h DATAIpaII (d DATAIaJIp) DATAJaJ`I*.g DATAJ`aJJ>t DATAJaJ`+. DATA(K`,xd'=A@DATALKPk?LB ?:o ??<# =DATA@Kf1 RenderLayerIMtL@N IMfloor01.jpg.001/Users/chris/Art_Videogame/BlenderBuilt/TheEngineRoom/terrain/floor01.jpgME=DATAM DATA JFIFHH xExifMM*bj(1r2iHHAdobe Photoshop CS Macintosh2006:10:22 02:39:55&(.BHHJFIFHH Adobe_CMAdobed            " ?   3!1AQa"q2B#$Rb34rC%Scs5&DTdE£t6UeuF'Vfv7GWgw5!1AQaq"2B#R3$brCScs4%&5DTdEU6teuFVfv'7GWgw ?YƦP}7}75s};]]/RE[?+/9p|2dx'?iSJ tB<#Jrںl 5܂IQ'*ed:lltockw3E7#D0FGG~ܛ7'!|?ڭ}~))o e;YkPI_~_A)ok/*1܁>_$(%r_np@6GPuYwې9ulho c5?Q>̔.GېЁ5/2yn`ל}Q ѭ n?W228\LvGWĻks l7躧bwhfx8}-K;c"2?(Au`s+is[Qk+ qwdK\uOsO"ٝ>*pP.Ϩ5~?Gi'ǧ\J%3"$(ye1ja%2.Q0aD$n ۿK9 xn?yK0|@< )뮈=e zm~FI -k)c6I )~#BjckO.z2˴}֎S[&+.`~ eZGZվSh4;hhz~ŁU_NOLĩ>lt@`ͮOf]Msѽu4w.|W(659ޣ]~khѠ-Ué\%+mAYn{6aKt8@;O"{~jpc= \@E9Ӽ!x$dr-"xֻ܊|TKC[P;Б檍,Wp0]m![}* э뵶7{dtN]I>rZa"TwgۏC%1rJI̦4=i|C䔤|XRtAMwE $V,N~!wmS%V/[&:seTm{l$FMT, +xAmWQ`s.kaŻh׻xsgZ~PkCnE,ko%ٲĮ}"KooT7goؖdchsрں=wT]gc'~Z9ng%t4M#, R,.kk=FTD]J)w"=63أ{PmXX_UsIѵIf~w۷nFVX۴$ cA#lQi/$_E~N̩SƼ>t͞ߢ 6`s~T$1wkI)8ۻ}[Z["Ϗ⡹)YIL>⇹ŠH \J <9II'(S).:xwMuŶYU2c3c7'˛wR>6]i#c[>`bd]cƺCZY6V;yq"PJqq0ŴYka8s,ggrșms#{x!վGk>?JʽS '>{qcK$leÚJw[cii%Sy:{7nw akm[C?cߡ@} s\&Cv>5m{_$[Kagi3_MAUi Cc9?hu{4_6uC0u0ӲKkIsܪya9qvqD{k7щ[gC\Аs9ÅZy;2?3w,?PAAsoihjΧ)t[Ilw.[[kk 5~m-gkC[]χ{A@zz 9a!{7"uLb($.} ~Nlme[/HL4:;p|$A5wIOޤ:D6 vߢ5shYIVYZAw~{$C(՗2ho*L':V-+;ZF#/ulaeX_WE_Kg}1Hha@`c}۵~c~[hIk~u͟IڷK_-sns{?ES-WV65Kwls.;[kG5v}Xg4l>`ù;,k'kK[yNf\0?UIk&/L/$cl`^ KGpfd k&^]yY1 tΞ]aBj?M;5;E̹+4U`n$H5l3[Uoѫ7+.k;8!}_?jih뙾5h|ܹk0}:k`qaMn* pk[.vր\Gy?",kmXI{C;􍪖Ɩ_W^KKeE85:c~n44絀e5,Co#sseZmmpZ\vm{CAkK} l9~\(Zftp IJ=¬X?SH;\*/:C}Iγu ZI#۫=&V#cIkHcXO;@kqgJz]n֠Nւ?sjgGeΦ6s-և{Kvnnc]53Hҍ! OogG'v ~.nƷcIslKw,O|۝wH,]jm5wsC"Mۀ,w;כK\8KFO۱}/j% ƛ0ݍwhQhծծۤvwr`> Eo70l9261߻&L8%Ugr"CZ\L]h vLߣJel0$"FlI(<5{wN͏m_$Jw ;W@@L{! ap}׹廟v+5zn[x?:r]%2}w9C%ku.m[f7[ѻWdP5Z@6ys[.ǾCƎdCǿ.2][7EQMk-mC0W?/m6]X`hkWms/eQ 9eeckV?mnS:dkVYX}sCwױF $on kf0mkڇ^b 0Z~zߜQO"YV@4Kesn]ih\='\KZG,}I?z*|.Tl d'5ֳ=_fY]xeCIxy}Qo۷6Eףs[ڀ4>-mn~{QEŀ5';m=BҫEP51Y^q6Z{wSؕulzA۞v@mfhvџE,ly$CۻslJ[?=v?OoKqآYsfY}~oQڬCǹc. =toG[t!>;vbUZK]Xٷmߣ{{57F;cbZiK{uT5kZ&y[EnSM8c\O}nzS}1j@ r ׍4Ձ덹mn [>jm'~쥗[^e:*k?EwbOSɺl.oFSmT6Cu7qs=3'[EgeuN!;op,N= 5o+ѱlR7:UܝkÅeuԳ28ͭ_ݮg-bM!k@1[}_{Ϧi`mA ջݚ̧]68;!eu;a8KcXm;BNF}Z6Vm{EsgCOVgf>5snSָì%%'`k}wװڮ{vpovݛh}VܪFF} ;\]"j79_[iKu!]Q sfFvױ;/\^ i}ۿIg󟘈ڟ;!m-kHf75Uoא81cfz~~e5uik ǭ}FK7zAOԭ]6m.}ߙS[[sv9ѽP27.̯֫n(_H Hj7Ի5!V ;.% f81KXX\ dg=ck`o.wclwJe]dZ]ʭ/U6ca c6n;}: \#l`!qdOa= 突{wKPZ]{JE/ met04kݷcYuc\ Y`㴻]׿-.>5UXƵlTnovFO,qQh~K}'{UR)V͝aЖ7LrARm#%Mc^`ē$Hi{=+N؝wPX=ٰZ?lJ:@d\=;0zmccx juX[vs[öcpmM-izM;HUuU>ޝk-q%T[*+]KieYs)2r=<<:ekt齿hw=*߿ҵj;ј\5b\vEޥAv01sZ wJmzW㺦T=q}o]ekw=?Wjɦ}W]~;vs8kQj럗Uּ>`h`?~V;4hĵM%;4:ok+՗F@Y K`Eu-fg0 =?SWsWW{C.Ǝ7]To#hf3uw:˿Y_袚$F-/},sPV&X]k)_Os Ik^O{{j}n_VOi ƛ#fC1m1渑~5IMm;d7ջݳy?D[-ҠR[l1~lWkǨ۫ c}OfC9Ͼ1kI+;znߥ[GN@:ǥ s۝ݾk61PX,e.>v:~n*VleV};)tՂZ׳*;`ʘA1m> %ֶt9 sL}kvwly{K=YE^}7og< >I?g;huB&ٷ9V!vnͨ}w)q=6Xc:h۵eiE$\lݞ$VJikd70O/{f8YH yӺo]mDXGǷs1;Hh$[KXAOc?}3~OԽ 5{uEs_M+|a#*Y fOcuΗc6ߤvSUhWV+a0O*[o[unzYsvUuw{`~k-[A#Q_#FOCPhotoshop 3.08BIM8BIM%F &Vڰw8BIM com.apple.print.PageFormat.PMHorizontalRes com.apple.print.ticket.creator com.apple.printingmanager com.apple.print.ticket.itemArray com.apple.print.PageFormat.PMHorizontalRes 72 com.apple.print.ticket.client com.apple.printingmanager com.apple.print.ticket.modDate 2006-10-17T04:47:13Z com.apple.print.ticket.stateFlag 0 com.apple.print.PageFormat.PMOrientation com.apple.print.ticket.creator com.apple.printingmanager com.apple.print.ticket.itemArray com.apple.print.PageFormat.PMOrientation 1 com.apple.print.ticket.client com.apple.printingmanager com.apple.print.ticket.modDate 2006-10-17T04:47:13Z com.apple.print.ticket.stateFlag 0 com.apple.print.PageFormat.PMScaling com.apple.print.ticket.creator com.apple.printingmanager com.apple.print.ticket.itemArray com.apple.print.PageFormat.PMScaling 1 com.apple.print.ticket.client com.apple.printingmanager com.apple.print.ticket.modDate 2006-10-17T04:47:13Z com.apple.print.ticket.stateFlag 0 com.apple.print.PageFormat.PMVerticalRes com.apple.print.ticket.creator com.apple.printingmanager com.apple.print.ticket.itemArray com.apple.print.PageFormat.PMVerticalRes 72 com.apple.print.ticket.client com.apple.printingmanager com.apple.print.ticket.modDate 2006-10-17T04:47:13Z com.apple.print.ticket.stateFlag 0 com.apple.print.PageFormat.PMVerticalScaling com.apple.print.ticket.creator com.apple.printingmanager com.apple.print.ticket.itemArray com.apple.print.PageFormat.PMVerticalScaling 1 com.apple.print.ticket.client com.apple.printingmanager com.apple.print.ticket.modDate 2006-10-17T04:47:13Z com.apple.print.ticket.stateFlag 0 com.apple.print.subTicket.paper_info_ticket com.apple.print.PageFormat.PMAdjustedPageRect com.apple.print.ticket.creator com.apple.printingmanager com.apple.print.ticket.itemArray com.apple.print.PageFormat.PMAdjustedPageRect 0.0 0.0 734 576 com.apple.print.ticket.client com.apple.printingmanager com.apple.print.ticket.modDate 2006-10-22T07:33:46Z com.apple.print.ticket.stateFlag 0 com.apple.print.PageFormat.PMAdjustedPaperRect com.apple.print.ticket.creator com.apple.printingmanager com.apple.print.ticket.itemArray com.apple.print.PageFormat.PMAdjustedPaperRect -18 -18 774 594 com.apple.print.ticket.client com.apple.printingmanager com.apple.print.ticket.modDate 2006-10-22T07:33:46Z com.apple.print.ticket.stateFlag 0 com.apple.print.PaperInfo.PMPaperName com.apple.print.ticket.creator com.apple.print.pm.PostScript com.apple.print.ticket.itemArray com.apple.print.PaperInfo.PMPaperName na-letter com.apple.print.ticket.client com.apple.print.pm.PostScript com.apple.print.ticket.modDate 2003-07-01T17:49:36Z com.apple.print.ticket.stateFlag 1 com.apple.print.PaperInfo.PMUnadjustedPageRect com.apple.print.ticket.creator com.apple.print.pm.PostScript com.apple.print.ticket.itemArray com.apple.print.PaperInfo.PMUnadjustedPageRect 0.0 0.0 734 576 com.apple.print.ticket.client com.apple.printingmanager com.apple.print.ticket.modDate 2006-10-17T04:47:13Z com.apple.print.ticket.stateFlag 0 com.apple.print.PaperInfo.PMUnadjustedPaperRect com.apple.print.ticket.creator com.apple.print.pm.PostScript com.apple.print.ticket.itemArray com.apple.print.PaperInfo.PMUnadjustedPaperRect -18 -18 774 594 com.apple.print.ticket.client com.apple.printingmanager com.apple.print.ticket.modDate 2006-10-17T04:47:13Z com.apple.print.ticket.stateFlag 0 com.apple.print.PaperInfo.ppd.PMPaperName com.apple.print.ticket.creator com.apple.print.pm.PostScript com.apple.print.ticket.itemArray com.apple.print.PaperInfo.ppd.PMPaperName US Letter com.apple.print.ticket.client com.apple.print.pm.PostScript com.apple.print.ticket.modDate 2003-07-01T17:49:36Z com.apple.print.ticket.stateFlag 1 com.apple.print.ticket.APIVersion 00.20 com.apple.print.ticket.privateLock com.apple.print.ticket.type com.apple.print.PaperInfoTicket com.apple.print.ticket.APIVersion 00.20 com.apple.print.ticket.privateLock com.apple.print.ticket.type com.apple.print.PageFormatTicket 8BIMxHH@Rg(HH(dh 8BIMHH8BIM&?8BIM x8BIM8BIM 8BIM 8BIM' 8BIMH/fflff/ff2Z5-8BIMp8BIM8BIM8BIM@@8BIM8BIMCfloor01nullboundsObjcRct1Top longLeftlongBtomlongRghtlongslicesVlLsObjcslicesliceIDlonggroupIDlongoriginenum ESliceOrigin autoGeneratedTypeenum ESliceTypeImg boundsObjcRct1Top longLeftlongBtomlongRghtlongurlTEXTnullTEXTMsgeTEXTaltTagTEXTcellTextIsHTMLboolcellTextTEXT horzAlignenumESliceHorzAligndefault vertAlignenumESliceVertAligndefault bgColorTypeenumESliceBGColorTypeNone topOutsetlong leftOutsetlong bottomOutsetlong rightOutsetlong8BIM( ?8BIM 8BIM ^,BJFIFHH Adobe_CMAdobed            " ?   3!1AQa"q2B#$Rb34rC%Scs5&DTdE£t6UeuF'Vfv7GWgw5!1AQaq"2B#R3$brCScs4%&5DTdEU6teuFVfv'7GWgw ?YƦP}7}75s};]]/RE[?+/9p|2dx'?iSJ tB<#Jrںl 5܂IQ'*ed:lltockw3E7#D0FGG~ܛ7'!|?ڭ}~))o e;YkPI_~_A)ok/*1܁>_$(%r_np@6GPuYwې9ulho c5?Q>̔.GېЁ5/2yn`ל}Q ѭ n?W228\LvGWĻks l7躧bwhfx8}-K;c"2?(Au`s+is[Qk+ qwdK\uOsO"ٝ>*pP.Ϩ5~?Gi'ǧ\J%3"$(ye1ja%2.Q0aD$n ۿK9 xn?yK0|@< )뮈=e zm~FI -k)c6I )~#BjckO.z2˴}֎S[&+.`~ eZGZվSh4;hhz~ŁU_NOLĩ>lt@`ͮOf]Msѽu4w.|W(659ޣ]~khѠ-Ué\%+mAYn{6aKt8@;O"{~jpc= \@E9Ӽ!x$dr-"xֻ܊|TKC[P;Б檍,Wp0]m![}* э뵶7{dtN]I>rZa"TwgۏC%1rJI̦4=i|C䔤|XRtAMwE $V,N~!wmS%V/[&:seTm{l$FMT, +xAmWQ`s.kaŻh׻xsgZ~PkCnE,ko%ٲĮ}"KooT7goؖdchsрں=wT]gc'~Z9ng%t4M#, R,.kk=FTD]J)w"=63أ{PmXX_UsIѵIf~w۷nFVX۴$ cA#lQi/$_E~N̩SƼ>t͞ߢ 6`s~T$1wkI)8ۻ}[Z["Ϗ⡹)YIL>⇹ŠH \J <9II'(S).:xwMuŶYU2c3c7'˛wR>6]i#c[>`bd]cƺCZY6V;yq"PJqq0ŴYka8s,ggrșms#{x!վGk>?JʽS '>{qcK$leÚJw[cii%Sy:{7nw akm[C?cߡ@} s\&Cv>5m{_$[Kagi3_MAUi Cc9?hu{4_6uC0u0ӲKkIsܪya9qvqD{k7щ[gC\Аs9ÅZy;2?3w,?PAAsoihjΧ)t[Ilw.[[kk 5~m-gkC[]χ{A@zz 9a!{7"uLb($.} ~Nlme[/HL4:;p|$A5wIOޤ:D6 vߢ5shYIVYZAw~{$C(՗2ho*L':V-+;ZF#/ulaeX_WE_Kg}1Hha@`c}۵~c~[hIk~u͟IڷK_-sns{?ES-WV65Kwls.;[kG5v}Xg4l>`ù;,k'kK[yNf\0?UIk&/L/$cl`^ KGpfd k&^]yY1 tΞ]aBj?M;5;E̹+4U`n$H5l3[Uoѫ7+.k;8!}_?jih뙾5h|ܹk0}:k`qaMn* pk[.vր\Gy?",kmXI{C;􍪖Ɩ_W^KKeE85:c~n44絀e5,Co#sseZmmpZ\vm{CAkK} l9~\(Zftp IJ=¬X?SH;\*/:C}Iγu ZI#۫=&V#cIkHcXO;@kqgJz]n֠Nւ?sjgGeΦ6s-և{Kvnnc]53Hҍ! OogG'v ~.nƷcIslKw,O|۝wH,]jm5wsC"Mۀ,w;כK\8KFO۱}/j% ƛ0ݍwhQhծծۤvwr`> Eo70l9261߻&L8%Ugr"CZ\L]h vLߣJel0$"FlI(<5{wN͏m_$Jw ;W@@L{! ap}׹廟v+5zn[x?:r]%2}w9C%ku.m[f7[ѻWdP5Z@6ys[.ǾCƎdCǿ.2][7EQMk-mC0W?/m6]X`hkWms/eQ 9eeckV?mnS:dkVYX}sCwױF $on kf0mkڇ^b 0Z~zߜQO"YV@4Kesn]ih\='\KZG,}I?z*|.Tl d'5ֳ=_fY]xeCIxy}Qo۷6Eףs[ڀ4>-mn~{QEŀ5';m=BҫEP51Y^q6Z{wSؕulzA۞v@mfhvџE,ly$CۻslJ[?=v?OoKqآYsfY}~oQڬCǹc. =toG[t!>;vbUZK]Xٷmߣ{{57F;cbZiK{uT5kZ&y[EnSM8c\O}nzS}1j@ r ׍4Ձ덹mn [>jm'~쥗[^e:*k?EwbOSɺl.oFSmT6Cu7qs=3'[EgeuN!;op,N= 5o+ѱlR7:UܝkÅeuԳ28ͭ_ݮg-bM!k@1[}_{Ϧi`mA ջݚ̧]68;!eu;a8KcXm;BNF}Z6Vm{EsgCOVgf>5snSָì%%'`k}wװڮ{vpovݛh}VܪFF} ;\]"j79_[iKu!]Q sfFvױ;/\^ i}ۿIg󟘈ڟ;!m-kHf75Uoא81cfz~~e5uik ǭ}FK7zAOԭ]6m.}ߙS[[sv9ѽP27.̯֫n(_H Hj7Ի5!V ;.% f81KXX\ dg=ck`o.wclwJe]dZ]ʭ/U6ca c6n;}: \#l`!qdOa= 突{wKPZ]{JE/ met04kݷcYuc\ Y`㴻]׿-.>5UXƵlTnovFO,qQh~K}'{UR)V͝aЖ7LrARm#%Mc^`ē$Hi{=+N؝wPX=ٰZ?lJ:@d\=;0zmccx juX[vs[öcpmM-izM;HUuU>ޝk-q%T[*+]KieYs)2r=<<:ekt齿hw=*߿ҵj;ј\5b\vEޥAv01sZ wJmzW㺦T=q}o]ekw=?Wjɦ}W]~;vs8kQj럗Uּ>`h`?~V;4hĵM%;4:ok+՗F@Y K`Eu-fg0 =?SWsWW{C.Ǝ7]To#hf3uw:˿Y_袚$F-/},sPV&X]k)_Os Ik^O{{j}n_VOi ƛ#fC1m1渑~5IMm;d7ջݳy?D[-ҠR[l1~lWkǨ۫ c}OfC9Ͼ1kI+;znߥ[GN@:ǥ s۝ݾk61PX,e.>v:~n*VleV};)tՂZ׳*;`ʘA1m> %ֶt9 sL}kvwly{K=YE^}7og< >I?g;huB&ٷ9V!vnͨ}w)q=6Xc:h۵eiE$\lݞ$VJikd70O/{f8YH yӺo]mDXGǷs1;Hh$[KXAOc?}3~OԽ 5{uEs_M+|a#*Y fOcuΗc6ߤvSUhWV+a0O*[o[unzYsvUuw{`~k-[A#Q_#FO8BIM!SAdobe PhotoshopAdobe Photoshop CS8BIM6http://ns.adobe.com/xap/1.0/ 1 512 512 1 72/1 72/1 2 2006-10-22T02:39:55-05:00 2006-10-22T02:39:55-05:00 2006-10-22T02:39:55-05:00 Adobe Photoshop CS Macintosh uuid:d03070ea-5f0a-11db-94f7-d2e171ffd654 adobe:docid:photoshop:ef6823f1-5ef6-11db-94f7-d2e171ffd654 adobe:docid:photoshop:df13c9e7-6308-11db-8f5b-fd73b85047c4 image/jpeg XICC_PROFILE HLinomntrRGB XYZ  1acspMSFTIEC sRGB-HP cprtP3desclwtptbkptrXYZgXYZ,bXYZ@dmndTpdmddvuedLview$lumimeas $tech0 rTRC< gTRC< bTRC< textCopyright (c) 1998 Hewlett-Packard CompanydescsRGB IEC61966-2.1sRGB IEC61966-2.1XYZ QXYZ XYZ o8XYZ bXYZ $descIEC http://www.iec.chIEC http://www.iec.chdesc.IEC 61966-2.1 Default RGB colour space - sRGB.IEC 61966-2.1 Default RGB colour space - sRGBdesc,Reference Viewing Condition in IEC61966-2.1,Reference Viewing Condition in IEC61966-2.1view_. \XYZ L VPWmeassig CRT curv #(-27;@EJOTY^chmrw| %+28>ELRY`gnu| &/8AKT]gqz !-8COZfr~ -;HUcq~ +:IXgw'7HYj{+=Oat 2FZn  % : O d y  ' = T j " 9 Q i  * C \ u & @ Z t .Id %A^z &Ca~1Om&Ed#Cc'Ij4Vx&IlAe@e Ek*Qw;c*R{Gp@j>i  A l !!H!u!!!"'"U"""# #8#f###$$M$|$$% %8%h%%%&'&W&&&''I'z''( (?(q(())8)k))**5*h**++6+i++,,9,n,,- -A-v--..L.../$/Z///050l0011J1112*2c223 3F3334+4e4455M555676r667$7`7788P8899B999:6:t::;-;k;;<' >`>>?!?a??@#@d@@A)AjAAB0BrBBC:C}CDDGDDEEUEEF"FgFFG5G{GHHKHHIIcIIJ7J}JK KSKKL*LrLMMJMMN%NnNOOIOOP'PqPQQPQQR1R|RSS_SSTBTTU(UuUVV\VVWDWWX/X}XYYiYZZVZZ[E[[\5\\]']x]^^l^__a_``W``aOaabIbbcCccd@dde=eef=ffg=ggh?hhiCiijHjjkOkklWlmm`mnnknooxop+ppq:qqrKrss]sttptu(uuv>vvwVwxxnxy*yyzFz{{c{|!||}A}~~b~#G k͂0WGrׇ;iΉ3dʋ0cʍ1fΏ6n֑?zM _ɖ4 uL$h՛BdҞ@iءG&vVǥ8nRĩ7u\ЭD-u`ֲK³8%yhYѹJº;.! zpg_XQKFAǿ=ȼ:ɹ8ʷ6˶5̵5͵6ζ7ϸ9к<Ѿ?DINU\dlvۀ܊ݖޢ)߯6DScs 2F[p(@Xr4Pm8Ww)KmAdobed         @ !1AQ"aq2BRbr#3CSs$45Uӄ%EucDTdt&FV7e'6!12AQ"aqBR3br#𑒲ұc ?ŗ>Ǒ?|% c#}ۗ2Dʑ"n ĩRGHڹ4qG2,mI0med>Ta9z> xw*`AA,kS'ddSxg4S$_ x4t=ǂGma͋ྏ ,{`>_?]91[̓Zrd{em؈ca2uy^lmA& yqdI$rdl? a?]92}y˳xEyxONLv~rc 1}FYAa>b_]%~`X|/]%Ff~2xqy'MhۅtTڠ&ES {ۍL1Ŏl͏Id@:vhD[<_euNb6/d߹/S̘}~C"dcE:_Ɂ d?1{$ /H~bF簞{$ /Qrq /52lMIId6^~$uDoIK?IK'Qܠ',jv[',j8&}::ơhuD/ ?^ORY2cay?Ib_6!=Au%~cN7/=cTΨL_vΤlgؿtx0s'Π/6aғx)>_1>?_2E<#  _X~,?gj;!ԏrxrОwLn6Gᜓ͊l<э PZNA-䉖y?R mnoIQ$;{+Y.Nsl|5>auŠϱ} &_t_=|+:}~ǻcqɻK:6c"6#KHHQSkq?6c8x +;b‘bQ@zX+7]o}<AromO.)/9cy~XU8 !eN*x 9_;zN $mo0 ܲ~s>!zq@iΚ7dU81oHcƦ?QSf~͸`a6Ϲ.^y`]t%h(,CdܼAlݲmj(¹j#ɘ)kJ{5SJ:ذ'Gz+X9^K{<  $hk# Zs@"P Rt=DA!Yi=@%Rɔ?H@"~ r'#R>/_?)}oz!{GHDs|R#ⷘʷ<U!vO)@vMQS/u~pQmU!߲anbm!߳yk i>qB݋K>B!!?/?7Q29>!dKQ2GN?S@~O?}' ?HB3rHB:oT .77-?"iaPgFkɦunչBHKWON!a/-+17_ѣ׵+٣l')}(:Ŷ]ug>z_mF3Mp+x}fRzǬք Rt}& 6 >z!o- /Hh@nhXupR[#*Oji}9"m@ 6繠A>BA~@%2q @xڝBF[fZGY 잏m{ڐ7BPLBu]} @0BE۝Jn:oA#t$r nsmU$LcdGMζԀ~"ҽ ͇@dx(qQP vh(H! wE {E1>ʀ"~ } K%1 \Ԁ eD_e5'(HC ( RǧB`ZA:P<.4hݔۚ! ?>oڪ;{ >okJ3:Šh?yo=?WYX_1efXuN" ~׫|&!G@>"[ u@u/X 4y"{-BF}& .~SB`}AwR=Mp> ~HhI_]Cv8Б' /707AM,z@ry@#u~S5@v'U sp2i( R:$j & P ~R}`M\|I@ ȃ+('@.S[@-,y)"!So5@ЦESR9ʠI>Ps/ ?Ǐ5Uv>okJ)užuןcQY:=7$ۀjq2:W{KP@8qPjnV<'@R_P aHP2 Tzr H4j46ê/5 q#orcP=?M @ M~> ZG@uU 蠁v+BqP6P>R*  cO%HLǣ)"5sm X~H{ [{( B`$z a,#BA>"Qi:Wފ)>{Σ4c4$W7[@RsҧPX=/76Ǒ W|~[flVG~Xj$PX8h>:7kƄ5\fkYT=$Pu(}KhLؠqBD,zMOEϪi"~yH7YUb*Iv7!KБ Ϫ7n&Aj^_Б7]=Py #epaߩ'@/_Bj4 m$DJxG ^ +:KMϒEV'lukz*|C@\Rݾjw>qrG] _Rj-Egt17k7p;g=5я:ulyn=SI]S?pv<չ7P<8~G@4༛ԦGO>~poBF]zEp]:ߢh iqk)#o94$u& %4$cBAߚje$А\| WNޣ@$cj .ИާQИzn=Aם6SH6>cA=^R AŽa~{5 Zn5 w=- `~kU z97P@Dֹ#@$cE dֿ3[(HTjǑտ 96rssY2p;&6陃֎}JaٛH4a|'XypA%H祅ɍkR@{75vsH$\=?UII?T$Ao@oP]ɶԒ"HjyjIDe=b-z4AY;9'u I#[ljb6Hq#)ryԽ" H3! }  6##X=>A&ޚ8_eH 5 iKq à E}T-(E_ 8d25ۤ7i|cv˳@N:#eF*[Hj~ˌ6GԿ\r1?Kj{H}uKlio6}1MtcF][?]u>t߄HemމT]gƄZ:;ןGnmF2my\Q7_I5Gxe=\ /B`A( AER +)$Dž͑m򳪟imTod9W@2CX0#  |m-m^,y4bHj;6PI;c"8sI%kU;=T/PH7P-@4!uZBX_PWE>7 yM$MBFUKK /0MA"/'I4uh?YjڄBAj{vMH:ϦI}뎣@7S?yЁ7А>_]C]/ z]9@-@sހ]}5]!cehHUI~ ͇a T1x 7"l6nx?wL|omAc+n^Kp["3U=~׷ֽL?!~S]8Quulxn9Z=o7/}~H8dR{׹QϷ<=vێZNu<;B TZOhA_rܰ-G#[ȿjkA2i!" li%j5sn"nb(AB@@S uEHi6$\b: #fR?ݠ+BAG0zQ #{h c:q4$xuE@ |>A~'(H yG:PjM" z#ʀB@]( U ֶhHK):<gx&$qڀ ߃OXH 9( @"äP&88jG_FE=p07XrZAʤAoomeERvvy>j1u[8F =`%￳3E SWȖ䂩ZNəWSO t5䨪?%iwov5kv*H"IaQe:d[I65 uks7q**]IYf"9TR7V *yCoya„@ /eύX@0BF:Ƞ{ \ GU P AƄ $P @&6v=5;r-hv}$Wz۪ޓB@K@ mom X렑|+omj"G٨%ԁZp:E@ :GH ܏81jmjq(9‚B4ua%e~+U@`VY.ܓ!n&(M^>Hнƒkb#K`?!~S]QuuןcwQx".zO&'"i;GG#`3y*c~t?9==Ц.;%[8^4ƙc|T {6ʁ C[d^ssfgK#grl$և*MU]X"ML IlLo7!=ؾ6)9 d##+4E#^ ƍ# - \ͻnL h>~ ōOVLQE%G9a!o5렑|޺ zzL2zȘ/hD*#B۝ȴ"As6"HP$AO=Uy~Z"(:y$Z;h$no2#@S 렑nw<(${3ݳ]:/BD:qn#t7Y-!MDrބ nx ^.hL}_EG{F=iaA!BC|Zn9GKe__PqIMT$ ~S ^RoYd*{śq [<Z/گ]w/TJho[zm5>rl]u>z7jɺ?bSW1HE^,O؁ ˩| NO]  cyP/{B濞ic=I'zH۞=tt@+WБ<$0$sPGM@af#P ^p az2W=@F0.Gd{P@nz@n(c% tqP #r>j@.(LYOXA;A.Eh F@x]jHOH0-Mִ" Qz.6_Sq}c;I<C3i]]e&bTŻ=ضAJ0:>Ǒ 9jYc3p|xDUv߅D?Fu/c;A朎VNLčhJGS"=ȟra|O -^$|H+~{}\lԵ,|i5nO _w9ZT O!niG'6l|\=InǤZd_bc1pv?7{(1'RH5Zel(p~*5 /]HYj Obv]D%UC3h1Su *U7L7ܪC2MW5xZ0!j"9P=5o΄)0]JP BEîN@Ƞ"١ 05@+}$CoeCMqh@8($AOδ&Bh$v|y$OC 3 Tٺ[2cuuןcwQ߇Rv#x0jHɹ6`z P :kP U-@ntu t:IචMd b꽪uOH:$F"%|riHLAtQ&3`xx,Ucs+6x&9`R ǥTz-͙_Nε8k_m #z6@ m @ǗBAh+] g^^5Z}4$E+P RtP5A /AO>z\uPvh\[ݠ<>80CuP }G!BGj=F$mQ*_GMRkQW=;/?W;j6? H9FDT_b{`mUk|}(˸gDZ]u>v =!Ou2'cx![gᷤT# $#;}L*0ni%:.k {hu'ƿU,y&%xUYѝTs pfAp!ztG&Ec z A~^hHg@5^_mYznz=K%{hH %{h~zhy}tP[&l >_73@W݁A`Oc8׈\ݙ2eJ,A0$SmC\{܋ds1X^X@9VlcmL$}ŽM5akRlתz0E,E 48{\M]Vk_ms뫙}u}t=~ > > 預[^-HGz/2+(vH BEe= hzj("MBۍA"|^m tP@moa:,$r> Cq!b~~4â/}t'Q"t$[phH@>ϮWOPJ}tN@uV .{xg^Fat}μmڤ{v>.f9ho&}tfvKmUkƃ#!L#81Lc*͙9KFA} sVUr Օ)|V:M}ty}t$]/ ::.Ǘ@+'Y ">kA#H[sa2.@ϗe=~+/ à]Uonޚ=MM)&}t%zmUDGH8h]A2-n m砐}fzݣxyhasϮCcOGk$Ex$Xa*T]E-@ǝU9?L߾SG n{ pٴlm-xtǕÉ`AΣLv-m@}?Igulxn9s2H[wy\y+3ֵS|%i&\r$coW%}xuP@Xߙ&u[uQ:hLx_"3$2 2VnӔ`ÁqcGvFu/Z55d}FӶ(4<>\XzV#6NV9DY7ivdn"ݮ~ftV@E [j6rEItߐ4] kВ,\5V;I!0 $Vk$iLn3!{z]>arǏnCwh#i{jSUi3ˉrK $uq[dEqʆ!+/*n,رc8ٌ E3!~dKR7*L{ Ш=*Rg36Dqc.×ޡ[F c·8H.5.bse*@ z@\uP@`tPx: Z RuPkNP~Qjw>x- #1kHPM@ uxy/BAutZ.(HGZ@z(Y,8@ )G(PI"Qei5| o "d\l?fߙjtr)_cҏgulxn;_ïexuaqha /k>d׽mW6Xie,G%QТ*$m~БqBVPh\y >!ܓ0RG+Ef(cnȳ6A| \sAG?:k[f.F:ύ/}Uӓ Q"MJ$M(BY@5[ pR2pwLY&Lܽ>c~HUqȌV $\NFʾ˹&CNHU†+ rz U:gdwp!IҼ؁{=oyK0ܙ?Lsu*{oqeYSW'fdEY^b:kca+Wě0d˼c=/.DHE@=(;GV)r;=$i+n,CߪW̞ejO߷d i$A \ER [3j Lz(LZP@5U ,$סj:( 0sATjD N  Өz Z֝@zh Z ? z=$@WZ_@`y =t&< MzEM跮P]ciQruPP窀pq@uE@a`EUDf)]zUW]V,Hbꜣ? ǃrqfq6yD Ď7U> ]~S]XQu]}Ǐ 2H_qX3s.e1V3q'Z l BL}WfР.%R׃|82'c`Kc J^itqƜ%ȭ<̘g^oA覾d_ ɲSŏ&~.T܉chKt,ijc ɆVRJl_$CCHSMDoMq2ɉTw2*ࣤuWEE&, ~] v=v>m y8C:{&ƢgFO򩏛F!-tMQf:6wcת8U)cǝ#*O8ٍ_HU/UM{ݸ,o֧ &渠"$Ԓ4<HGn,^-l)qb?!n<|NjM %!*G ՐƗz *-cLx1DVJ fܲ;V A P<[{54$|-HjXu #*. #(|}>o7{( z  >aoE@ c0`E?My@w(L [#AWyh w|cI:{I-y,( p[;ELP@zP&6}Asm'ÝdMJ-G#Qe#k.l xS*cYl/uN<+cͶ [N>ŶO뮾cwQd\u3.gBwت%Cن%Z,ti'VVAJ9nۥ6iknWs4NVfg^vV= U(YB47s Ȧ#25ұ2͇j֯,T=~Xs'` gpAQBt:޹0XjJãFߑZխm 0SttB,jCʫnU\`O"94MV66X79V<]t0WX*H]GYRhadߙ+˳lj+(ŬO$b<&U~ǻt#Aj q>!9Gd)n>g:E2de (\:Mm1MucF}{6<uG{!u՞멹 \MeϿÚO=xRoO6-Ȩ8eTmRWQޓ_nmbX:x5Ud+7ʾ"U;?{Lő4C?Tn5ퟪ@ljP7=7Q68lp/"whG.c_ͩ+:~<^.SOIް=Uh2x;;QiLC%I>fǓV'l}* \E RFakk6[&6V[ Q28ggmܱsؘ*?_)+JL2tg]EX jͨgM_*Ϗ ychɸL[lji^g%W sfbW̋#&M.npN^ĶT,}r:[UJo%qdڶ 9sgYvDMZ~R/ƔuO8<,-ab=_)VCG7d kyٕYb78dXHM^L2Ӌ6GNE\Bz$$\9RC%.>{zk;^<.YȎXs@OUAt>BG)o gB[@kTmdBC=~ G"% mMǨX :aKA_U޶,PZ4F! k1A^Kdy7w65D/ ̤=1e7q3(1`ߛ6GKLꫣ19I KhyNUbMK=Ut[Qܶӑr^׆|//I~:=jCnF4!vL88fETgEG%lkXfH I:׏/VUOR5{i\@TAdP89Z$s$CǪ0C-T XPp@j s qA( Ta83rFɃn .J*=gD xmnp.˩n Z!Y*bjsP%^5 oޭ(9ހb.JP= w - ʡC}5(^/]6N`픫(_Ci-#[٪rē=:TXAse2d367(javjC}5>Zzh ʮMrjYq!%gTqorZDP4A5Vkc!@9AM>~1PqϬPddR? khH݃,JhADz*d4hz:̄b,s[=oӖ kW?I}(˸gŠ|~qk>a훮vחf;eDn$FA##\_^Fi$+NI=~J8k,uЙShrUĔ,ڶ3SFf{B6ÏXMs!UiRD.wʛj$edƷ>Cao0WS/PaBGP3MFK XC$x\Bf 2lس%ōmY%:A&\USkScaݴNY1`k=rUQ#z`*V%hYd~V.[c/d`(28ٌCEÒPx}ϥl2_XH5$Wf 7m$l5/qTwFgYDYg:TKF3!LGZ G暲mo|xcXIPkQP u4$u'q̋ ,(d5 3[^=?%JG[cdn!5aȊVKRήLi8ԟvXubs[TM9g Lly\~RheOvU# 2@-,xFM={hs@+` ;"3%ψdt׸Q K+NwB9k_H Kr $*B:EE*lz X` 7X 4=6#>OU@/<W_<} o΄-P|/ xo8{.xwr7 ؋J#P{ϒ0O|,ąxMRɓX؛VDw2L&-SzL9aҏ?gń|~qk>Ǒ}%nWԚΛ!ݿ?9c7AM;7LwX{EU?/u/+4J"Vv+(nUK|`ev'&nVvI=Ib^faYxNh9z'2$u xǨiU0 \Ęsǔ''R0#=Y4Վ:MtƱ[VGv&}[+ϋ*dF=o+k%8K>~ n\65X/5mZնұ @#[dHK8$;lrr/p|5}jS)nx c)9X8dApݟ^J'_M^$ē]hSF#A?2FߛZczgX2BX⒡^6<qSe(;񴘂L<&d@z@6=b<Ք:13G#dF C>uLJf0Ã8;܃%Azڵ )@-RL"cb煒9/݆'Qd;%x}1 CTFFe5-5# I?- Wc,1 $ '<ce}C-w뽪8cZ zaCjɲQ("LLK.KOH50T;$ZDN^(iMHN*;F;&-UZ)Eb{vil teL@x2(IkT8ۅᙝC݄dWMɹ 7EefJ'\4K@t~lS&8R@7łSL$R'M.U~hA!BT$= C$=P u{h F@VhHѠ45u@Rt޶NDqM^,ضo+d,Ur_mkl}(:Šc宾cwQx CEدzHZ1b?l}'Ib~-߉_u/HlY Bo;?Mo}, n? 8]*܇[Jtf^y m筎!&qˤ^rlX++M9];6>G v}L~S[cF[?_q> n/mL{l8'I_t|cF߉?r_"I|=`UXt9 &'nҺa8D39#V(o`J)17 'gI!N2M{ܺ-Y[VvaQY*vvLbq## ǐ7M5[]޷,fl6Tn-Rcơ<;&>1őr ݈"іΝ~EVN2>)dep75%խȲ1 H\22ڲ_GG(8̘w{ZEYJQ>7FA@ ^ABA6N$P .lB2og#ptscuopj<:FKBӑݷ GG5e!7px5< [ zq:nTs0+Yb 9VmJ(ZݠvoA#>1T4$xz(@n?[kw3'pw}-GWb"H*.-u33ly<Ҍ{Ū8|]u>GO2H}߾/vפ˿@_ ;A[GGUǷ_]KlFIG#-O537b٥$M }&O#S_ǵj9g );$)ٱ-o- qnE#e37tBu^zly*Ű#FN.㊿A~ȩLǣ֦VjɎ h<lTꋻ1|[Tط9TlOYU+cebF<+({CRlETk"a.t=>LNbig7;ؖPxj=Q멚\\jIO[8=)f$.Cq{UaF\G#}(>QǽڣT5>'$YZGE%Zdvo]I{3AFX!f#&bIEdFع 28zk=R_`ghioW1d/ڏIy{hHmr@8(T^q-€C_U ]Tn8k=PʀwkTݺpgBCwh - 뽎Tw}N< 5dF}}ḟ"ǣ/3kx_MtcF=3uןcwQxh3gIuYbbTh))ǎp1q&hؖIG % [V楻g?g?5=r_#h󽏮,e3n[}CS(/vf \vk;=tYv~c"rXԻnF@/B|_TΈӯp'nٱ;7^aT|+稘س[>5)ϵ:@rqf'ߨ^e|uٗbÃg&6D ONxV-Z&GbnDϡ2% f]*"3x. Db!jئ>16ˑ=# ɬuw.+%\.&U n# V;hiLmExǽ6e>QS[&2ctz#$,޳*6Կ#r1cdy7fIգ,U0$ p*Irm?FAR+C!@>+?j-&s2T rt pk&ԝt|Q n͑ b1v֯ѷXzj>eRs]@ʱd.J0e Й, FUVw6!m4T *Gh,1vL$܋Ů~-E/i-w8g3#I{`ζ@Ǖ[enm~IFȘ+N` ZTq|/͹AOy~5N2m*6}'5'bّG9;ߡ*R$inq3.\+Jv(+&r}ஐ(qD8#IXMaBD Z+-@x@nBG%9נkG@;Pt&Z@(?0*sXP8{k݇Mg+S,H֔دpL?TR<&IȤU2엩a?ˣk|}(øg]uuǏL~FCnńWI]T;G8 Pfq4꓿}z>*Jj{Ázͽ̞)2Xvc!˨Ȭάbm).bn{s.&'S %ŎAMͧkP/%_oY4u/s>}bKROIf,P"įvl~[ -dldBؒ JN>*N+M}G\i^}kI̘>{[pOX?%uY} kUxߙzU%(_}`o'I$jKM*ɝ .G8[:LFPݒ9O'='Vm:իnI>|i1XfjK=[?9b"\ ZƗ 8յ~F9~SIVu^Aqhȏ)E<-n9ĴÐCKHHe[H魫iGZq[K+3*#V/VvcnIn{k1kP,Te)U]|G!E"ʠ-Ǎ[aMMI@EjsgEh\oΫe(/G/inW{:ɗ:cRHl:')"#VKe.KG#&A ef&#MtlS@l+.Igai8] oFY<:Y$>;(p20~XݵAjIҊ `p0C%ly1r Orn,Qnpk]Ñ()>e}֎ 12>fhBٱZ:ХYAm旸9DSqzW516Yɛ9DOY:TUB $nOM-[3b l|ATؤ|z&so@>Z&FЋo,"Gj#7vJ #'C(LFz-A#($xC䠑U wgZDA2;Cu-#u- [Pߣj5æ3e2G*v-zm+~ĊP✎1uk'Qff횾 G5>swluןcwQC&>iUُ ,|rX: QFJLP$vgEi\U=d_ <ۥl؝&.:U/5mZB7wܬӥQuVf+IyxhVQ'L /&W~j͍qe s༆yC 8p_*+x| MFkp+[)9iwVcIr%qE=${"±-NӴTs|=At͍' 0ui$Oӈݓy`'R U zaH'#FQP]zU.p} FJL ~<)U:g] eɭNQe[~bcJxtԨMVwY63vifL!rxԬ:n942 F SBlX~jfnk,^bOg-'i|=$8qoAZmr%hA  5yjMӻK``m|5u|:ΣPF;tF.&\F]L\9 ÙFWW&U -ōflf$ꁮQLī7=}Pؑ!MmjCjAv !.Tk4#qjջPɁ0f_q%h<*4ot+<U sBbE${]u FoF%'+y,Y@'$/I%ۏ]ێlDq哫j'YLW;^<`޻%rڄfY x,#=խ!!{ =JOcύCRR\,ѶCˑDxr~k;8PTnV؀<Xt&AK   нͦ+RMtXF-:&4^7+>S$k[ZuVD<#iFa4 cn-j/\S%CFdtDwD~ Y]'Jm<&qܨsffK)5yaPXqZ$bԗPltІ6= qVE$O٬8ZiɣWF\ZBP[*ݲ}*`H9Hc⽛d5vɫ1q`Yqм_x`QېԫHe*X2a%ǁ8txj92ҝ/OGME#!r^n>Pf+_ĭG%L9FD@L/-DA/C&M\marqtBjҞ0YRD)`$Ia-η3|Y9)AAsROT]h+wZQ]C'Q] )Lj#UYB[Idxs=F#Q} \t%c,x5c15p{c<ŋ׿aң:0Un;klfvZҏח g꫘AS@81qAEvfZ#ƻr׼ h4@ptT铨Z @PƀokJ<㭟]uz0^\)ٲU6 eN asXєpnġ1q>VUog~הf.c/vr"I/Ȱrlf`_RRFײ]",@MAd2p rl rE+yDp٥1߁k<|/bI~̚6A =x-*ճ&z(wVʜ86!UlT_5Ea/Q_'a7'`Ɗ9f#їYUfXp.Lzk$^XFDr2\Ȁ߮ q1q#%a/x6Å {^9ؾtcVnJ\Tq÷ 3,91d}7[\{|kRJb4ՊjnJ+(mmĎMXD牸pU)4ʭxL9J+ɂ*D51q!<khLsV#l$wQD[hptޡɢKZW48..NITscnZ*sF[۞.\O+ƪñ:c.La1_er->pM퐻42,ݿ#=d | :J/X1dS/w$~cZZa' hǃ Dr :+X#.Gc'lLȆ b41joʳZW|WYm.QmAjV"Ka&OJؐb_z FY>!v~)d, {S5:Vj.kVWwlLkF HVOSTV̜nHq~*d IċsH1A4@9A ΄˅@zHUK z="R w!BxU9 33{aY"*2َ 4MrVO=M- ZTx:oYYSK#>cҌ{']y<u)6>2 !kI]qILm(v@#fDŽ_1'q1cEV Z誄r7%2ELBAv<fSnn; /)ƃ_7[V 2qL; *k!HVV&VRp#lxrm^2:IvUuzdljǑn$Yxeq^^܈0ƍ&F+ n=#;;Z',l80ᬫ3$eUT{aǟz6[IgN.S QwYɈIlV@ ƩCؘ.5(Q]ppW{DBrow&7 KǍ "mvf9qqƬce.D3bdAb8ܛ]5T\F2 l_̛݁򪚿ߟ#f2 "VYmxպTc®LuLN63yVJ1s\aJHXXRvFe] 3 KJVl=_i2K$N˴$JW4鰤e>ZB7MDrޤn~ ~,4Ý#1,Fjjd>UHC>j瑡[2~bHB?X_점k{($v[($pV@8#=BHuP.B($]ߔ@28Gz@x{($AG=&Cݎ$:7pPtN 4,.TVVVG?<7͎ drv{Vˋ6]4o/xe\lNm(;Kvľ'~]Q^>Ǎп%+I"\u^?~u^ոև 3[{ q+X_xTɱm6fs!hZq[V5rsMő.GQa`ԐZl`[t>$$ujFE28LjṛֵjnSSTv4WNBl<,YN=S% "& okX*-Y//fKȁC8LcMM(9r ݛf\yzl\J=,1 SG} )@!CEϮ[Q9iS@I,_~×l͒IiaL.Gh7i.,de;QUmG^ڞqbb(cv^ IKdWV"`C>$g/zr><9ڔ/.(H[ղr7ѓe~L/_#@ |zj cPHlms{P(q Ƃ@Po=@4# mbj D~C0.uV"f3aec9'7)ФTz6KW]+R=h(1d ߻U-W82]̽ Ͼ/z3QWpix>UQmq5Uߊ!~BSekv\E옕2$P2/N+3I ^F$J)h'-aXVZnڈ;qٹ2,& eOcI'K`Ō&ۖ# j  4؞[]0 ݄Q?b.]&k']Q6nQ̱eG,i*ZJYk;3rH;q.M@Kss~kh̭$>0)žCp6?0[n]+UBO3oeۈBҧQ[5Wg ^}G oFO%aRoʷyO R1IM6 UtgFE asZ&4chGĈ!c~k(jVoE ٕ)2r1 ո9+WgHI%>.čy<_ά^y?O(ęztȎKrR+co̔~^sҾOUH3͟}]&0# 8&'F uU;xk>Q҄˳AZUi͒982OwƸ5<ֻ}3*qib7n,TY4_Jwk܎^# {OH:G(>>f&dC,Sݸk ۓgܦfgœqs4ֶ*72 .ݹa Urbcce0ZC!tLV5onXblk+Nhvvړ)Ifݽ ޵9A0!#rSyZm*lK{nbLr ~gTo-z)>V.jю@&[jDzSj\y*v6Ռʹ IȘFжyQZ4E?qz cxu?Dehg}PG&D%Sqov)h(Ӵ*3{0QVZ3PdapEk2mlfmg@{S'ju91YRThLYwÔ_*W[zoW۷(L]ἙR3owG zjg]8D;\/y"ЦzzkB;7$UB Qʄt@C OM [PRoTMGA #.E7頁-A#@h`nY`ZQP 2dxc’?-oXd:f!QN㭟{']y('Lݦat2o?U)ugrrRc0vFR*Nd&[,7Y7 5L~Xb9Kzf)#ݦ|EaݸʚD%=j"kKi>NnC+vU$h@1={_Qz%\u276xdזd1Bu[gw]X q*mGU5Rԇ,1)y_ S$$R2Hb/DHƪ٭iln;H jW լI+:h|[!OC͐p jY,zoq{B@$q S9`"yZ8bbAn'XD"d|T 6#6'Him=>cC!"x[jt&ډ%ͧݭ*ʢ9e-lQ)2 {=+ԙ~Ė]bƇJjO ُBk p]+$'FCt` ֈe.럻8- }r]4HK9=$H^4CƙLMBrA^cêk}52v 1v+,;AU2$ڔǒ,% ~z zM^ݴDA4eLAxq?YI1 ~FkvdD$z9f K-,~jnA V4a@),6n@Ǐ"Fp +ĒňFBE*Fvg9Hѣ ~ϒh@>#kdK$%Mb:.Y ɩ͑)UMMh"96ai|ȵ5FyZp,syh 7ڇA ~"nh Z𱠁o@N>PIkMl]]e~RGC3$2GX:FO!y~S[E;?>ϱ}ٿ?J} MEtQ{(2+I Ry{ Lʧ -k-,giimkgyu1QoU0̘|͍Sn>A}Ѭu:U%z'"L%bbgb,m=^-(Uc5ynۖ@/{($mxYdi *4/qZm3;&䑧ɍċ5 ʊxhe3 U 0"F{3msA8j A=U[ p+K9c>ݜ"O1Tëjv;]SM| U <)bi02F鷦bqe&3b"Lr:WUSQT˻1Hӵ)nE}O{MzoIUXI`Ѐ(ECyUG~`nk-d(P#}wϷ+|y  dG$OT ߗ+7Ti"P*dVX\'.CF%$o"z栞IhLqm!1IFv YY 8~P@6tZxScH& xrkkג9,}5iQKiǺ?{~A8'ERj9@G@AG|$:'O&JɭNW\Z,b8Y N,xûcg|-K[c(]Z+$EM(3i0BBXg^Hϱ}_EL}CIp2KV : H9dxxiO#ֺ6kaeIQX<yǡ1h U7o"Ly#;{N {?f/\On~DIkE eGGjS1OnVij^7:kUF]gA`ž'f>V&~9bʼ$Fd'Ҷ&7W c BT+00ܵ@Ѝӓ7ӾH(H=,KƓ\LݼE=\Au1j͍_o_Jcd(6#[|lMП*~fm\h@vxvˑgx8\l[G2̞ zfdTS}I|D37'EQj-ěR!1OyϤQ~_ܶ27 2 U Acbn{g~ '\o+ /#&ڬ[F,D!Lz1qgp.j2֋I3BGEhs4tTL%\Qo.;yK{Y%t"Ik b&*etDY;e`Lj43լz*rbRZZ#1ŕIjej:+q⦤.}@i5p4 $PvI"xZ],/΄h4d/EC!Sկ ߫'J_ac϶75>Sgœ$4f+[0ҏ#~ Gak* \ 5S#W ,dd'tXۂqƽXlwъA |ƐŃ*̦R8~RԻIcl9㼳; (RNJ͙t]eK4P?]n+X9fw`dq#!$N^<, d?5[liM̃km-VT9=<*qS|pؠF,ܵU]cUN\dDxbHYmUE1|ى*"4*'*ڻɳ&vPBw8tոZO_'y"Ā*("B$hc;Lƭ1Jeiw6j=5".{laOSj{xR*d25&d`Rl8;CwXٸ Y? <c U^;S R. V"+DgX B\XvFMke[<;,mfuRhUWs=&r!F{v^7B rci ͉+t "SJ/ 5TܽˇS;4y }V+n:,vNvQGV#7*.*K;gÐpY>U<8uO2mԽ |HrLm|iW(x̬ 20 S'=Tq>T[%\*J%H6U M >4q$C\uq7|vI2&MrU.^R_[9oczK 9$K2rà^*67WCA' ߺ:x ;'7eܵ0}B҃)Lxn(>Xy8i;R_1Fi){ m[2fg0Ј=Vҿ3VM?nQ& ty MF:oG&$:13;I'GVԽt]L Ldy-R-dHTBW9:uOoSju6<nmȊ\iC2 1[ 5SOI,BJ}ٖ3tTsR84yrѵѶ^$` 7Ueth}?tE#.]O5$P`dNNI"Wknͯeh7MW`{M˨VgqgDǞL\k㏛{G5.k-K+d2"bmE&k?$mUu٩ā*w<.2$$uhgM2F2qGL`ك\~-TԜI|)sr;zUomMMl2d63JbޕcsnÏUCEq%Mpr ld%c,ucRIrxJM.ګr&0w1T'}qF^N.W]>6ll%x͊d DuDKgFD.$=Me*#ڳ<ʚINn6Oz' d^],E%hs APǑ:5IxRsނ:XUxjhbUA~$pV< [&C': [BD[X/DϮ:BK,i{1m ,l2yAOƬ>(קH{}X61Mo:/_>ϱ}yy&G+1?ا+»mG8h`mp;=TK%hdy9@&DУʶi¶[YRVim%V8T8|)bX=&= SOeI`ݷ)y {z5Ʃ>rzz^cWwd f2).¡顥/WcwlC*G] U=50Orcr:n3W跽NN"O4e` <ڲVظ:M5pw+O22fmPDX,KuTmfas&1L Xt`h%+WTPqp"M :|nt$yyVwQN rv̍'sTq6V"3"޷<黍 hKM( Q67eͽSoQ\n9YٱmJ1o;H]Â/TKn W&.oy\8,;-qTC<+nu+dg^#k5N95,F#,dimyIHFV6FPˁeR;ėMuU4| \[eg)O5zy-z'BTJ/{_sÀSB4d&6B^99H#(&92bٳ.1!cD/A?=Wk8gKX.lfLѭalu/EYWR̚YffbH䫘 Ǥkzh/$" PǡGr> pq'$6(@%{* >^ tQpD`܊%o|II!Rj!F==&qíR0'>NfLKVR0UӨ5҅5_Id[ֿ)}(ø~/_>ϱ}_9QXMė@xTgBgGFq}Z5sw}ŭ8onjkRx^LĀNHJ`%^'E/b+=-٣96mDTZ O=JQ`l8 qW:BlUVeSoI"&{NJT(XT(ڸnjkYq+|-$`8P70?ZM![+9cē̓P6nYr/8!ӤZ;YVw2xò!c<zUOQwۆݑ Io.6n)}yT+Jh4ZX'lrIu# *Hά]v7\m'3$K$6Kp$+acGxܸqO裎O| n j_vT؋b6j/2]sJcc RuV#OWM+]n岲^vv3 {%Τ%g%H-#U kQUQm*)zD%Wo(O{_.G O6W^cy[?QZd< K"P܏8=5iUr]tYF;H .~֞"Gz[-۶Ty;m&R/ g颊V[r߲rC[0 Y|Ž͓LJQv۔e1YmtfO.LJ0;$ Cu#zydL9s,=#+۩Omc6&baYՅ]$+tUr0Q|~/ @MAgFt0utV-hr9m!rr#‚( 䬩n'MYݝ*~%,ivtp r.~/ͪ{hC6VO2;m*ߒFZ-~>ߑyY7%Q9X9o@ A'=TrTtԈ:@ e1A"I sƂkנT ۈQ@ m*Tftad2 /Qaݎ`gC?ڍIE Tna ?u+;#ݪX-C?I}(q_뮬7zss/ \ws>PG_/\ճG r(g^*6Jq{T%(ý>]q>WV|[-27-LU53[$LGcQBp-vcÐ?G-| bQ>r49?|eBpƃFߎ¤ݼ#&ZZ b]sna ]W^+ҿjqG|rПA*Fv/oe *[UɶgKHlď`:p*KSŒG.133"1ّ --R2&`Y 1 ֔^'6[6RlgPe 9Y`eǝM~{[vѯNŽ/K!WRyŬUj3d&vzt pjHceclA ECRZur}3FP,TsYqgOXyK,H{7֫pܷ+b70dO}T$ 'YP?):SPY-ȚY|]~8h57Qh:-@ 9G„<N#; nNuvUeϱ}xcj=v/hDtN>ʵN\'8fa~Ez-KQTm-r6GGɑ4}^+g1+2_j$GuV629Zόqi/E0H|_X-[hw]6`sJ3'FyYT ը#3m"1MDn~ۥSQi $۶{[)5œf 9n!#"e#U5%e<3w͒wQDz֧N߯Nc<v1BRf2<5බqrYstT+1 8OyM9[f3gceO @j>]$tQLdez]Kxh )S3lƿ6?OΩozWq,0cĕQHQ/lS< ٣.ߐGh֧,ؒ<3nw4&H7|7Y"'gtwF/\`jg&GOUmoݦM$sF:\5SRp٥]dA/jS3z(2l8ܲ!\:PUkSZYٸ݉Ȁr"Vadc@!4"R%d.q1prnȠEzBޒF _2>MkU9"x[Ȗ|exeD&Au hԊah@l@t h?c5JM1ٳHǏ$FV L[>#;\[􊛽jh?# ݏ5ʋV(}˩|<(s讪[(g&v>jUk)E[<).t+RL{7k:gfjMt!΁?P+ws%/̔DڣjF. ٽY|ho1QW"{̎H?HςGI4ՑϹv!i@I5۱/%%dI:$oT2-} SDG›z|,iߏ5_oȲ&IY^9 '*?Oj٧ ʻPOZW*nPz| һ Y&fg͜rq2hRB-+U׋%x&ƋY|LL3c+ځǏTWK@受İPNi@X Q+p&21Xxq,JxۋVvzt5TV>ɶn}G'\3GYGTքW5oVH^LYq#9lj>5>jj/\Y.wL򶉚LK~ j[obUuu7l`='ڨ"\v BO"l|Ǖs / z/F .ݒ6BH{KD]~+WNDۥD믟effxUXvNH>Ե<{Lzh #ou>VCԧYX.)Ymr5r zQyylnK)XJW9ޠ} 9l_?= +0p_GVK7g[뮼?ۺ΃C~nQAޣЧ|׌xg!P|5?ڳEԾGSXJ9t]-u`G1Z`xi ~K  r_ڬSI\|J/,(Ef7!G!H/0]wE#o!qX 㥾?SW22dVHe?v\NG&)$nX8"Q|LOY5zKZXb|j0z B$LJ.MFJN{xS:U8<5K6nNt⿉|+GܥSn1⎾oZĦ{aFfə#Qnpߐ^\j^FI_njz*g=ƕ/ɑX{qpXo%ґ =`AJ%:7jd܅u17?;w ;Wj)QsP;Vdc+pvai)7|UeNn>/vF~UTVz]ڶݭybnGH*F3ZFR=ph.{S7_j6eX}T-Xf9$C2?ECD&|Qd}q`X(>y7J5emۍwl5˗@Pɣ&~7-|i_/1խVucLld2þcflM[Ąj2O#Ym |\J7N(Їyȍ i0HTeC2ߘn JRU}.@]KaT呱' E'iVW5TKܽEǧ8IZe/I3ϸ!_d.A@BŎZ)PmRܿ*"( #Tu,+S1A! h$puh$x~\GEs=f3ØM~Z-S2ϱ}F$3ZP-a~?~Iep?fȍ_? g|CV&q_#w»1yL3 *U@ۂkWgzV{Bரy ^fzя.r0uM.Z|kPʭ͒hr!P8YθQ3kyyX 7" KvP^ՂZvN)#Cykd1>kVuJmm,xW#_a×0GArrZ AR ۞׆%ӯ"RV<9-Rl8Ἥ.n( I O_ZToVt:FCLjMx1 alMU$jۍu5p}h#W/-M )hAz](9iri:GB9'F0Fg{U:WkUۍiEvݙF ELm `@Xn W4n%h7=q;bT5R:z(ܦEhduL*èa0j *ilWSƄȲaΏ@,b|ƪԖv# lHq+FIb='*m!lFO ='UdgU=tmx{2RMB+F*bg dUgFYN.O3kVW:Pَ;sfwCQfȍ4f,X>Y9Pakn7MI@8#tU< $,M АhOԉ V5[A Bd: 7+7 ֹb}T%7| DŦZa5_bn?5Y9g5LyqzQWJ6재kWϗ5>au']y_3 Cr^v#=8m&AT|MD>۶a@%sP_ѭQle l@V2d3&PӗJ3 5Ce{-gW3)>7=-"2>[/ݓh1>550ANC10)WF8j ²ȵ;{gkĵ s0KєHji[jS&Z.xr9#)5$QM]c[[d%3bl;[֬gJY1C69gn _'C=ߠըwIŐy*۪a!<'wґ,y8FI"LU6l9 *"Hn\$,&34/z CRZi16\g8ȧW!aed3%m x-q|vdR]u$enJ:Vˡ{?ejիf7FlEh`/=@W_v̒!DIKߤZU3Jb嶍IJUƝ|YXOe S0lwW(w\9Վ\1ӎ*=MTͳVyT^CފnAvo(SziKWo[a*hȖ?}?ucimj wmnELjov@Ǣx@"h !G #&3B`X K,dr4&w_PC%N}TsߍѪo[H^֢3_^T:ىnQ6fJ_DP=ObmV&1.r?>ϱ<ܿϔpgߩOly)~iERFW_GO71#ܚc]x<{bebk+?ߣ7%UOCӪ'Sb02&u[CJJS#uKB˲iyeHwc`&&)71ϊ:d"DmŪ{[2M(C,49M`ÖUBڭH#;HP:eI/qÉFRZZɟ #b.#d M2uroi&>>>0؈R7[9WAn^8_RTEOEϪpo蠒c.iq9.@Y>iy$Â&7TQmfk&Md/*F /,`ࣉ<-V1UF`h)N|\LZ\W.\TϑV;M&4ْG >SJ8*l8bm:O)?ch|]|A,b{O:E* )fe͏$Xp#iCAoovGȕ]=Z|AwsqI,J8ړ8/ds1$L)ŐX !?Hdіͯ#m!^tURn;c䩭Z3ɑY/2Յ"U pPAP5XP B@M{PaR-oxT>k5yxP?{ɮl̥lk+:c,˿9:?ܿdLv~~]Qq{']y|, L]$w䊻a;tOIMiGwp7Pin Ĵrr2cDH:i$Me-4+ >Kr)8l\1E n} TbYy-[&ۇ]H=xzA%-Uj l lU.oۭgɂ-UFr\,Iꩮe~ēu#յ!po]>[v#%v"(,?ؓa6A*R ×G^*ì(nd?ݹ2{{t2PjrQ@{ⶽUlpY!ܻnh yNޱ-&KD1^G) h!O/]Y_MJ<h}w\|IŔِ_-<*,VtnQOyyp--Qa@95EC4D(]<):op1W\\P~DNhß $z#c~{Vi/mF >{Y/˵~ÅdxY)ʲoG&":#:د*^UQ3FtoMW8Yݛ") $k):FD})od=4xۊ>jR MRʤ۰h@#XmF9lВޚ@>gi4,|5F7ǎKq8>G'sJ1!uN 7=5(jQ*շ5r'M'k7ŔuڗM Uq%\oĉ͞L\a#} F]u2w7^!: ;aMz#ɢUb\8PE/u)Tj@wpj'Tk~ckh9ҾDE(~3ťu|2e ?TU7:צ'w-Okrud>QRcZq%(?Nø y쫘 u.hƵғVr&l"fg8ͅ8H/yen\iue[n/ߡ|и8F,ٛѴmgGTmkIFZ' 7F _bmψvHe#mL#)Tn+ᩬVxh`L,ڽ@5wډ&&Ncy]Sg`kI>ԛ:ﵕ#^[A)X0ͷ'gU|Lc!U1BZ:U?gmwM LCE}qj A 8}7XkuA/r#Fơ獔XVj'h Ԁc*lh@` к˃.Eˠ'6?1'$CfƤu7RH"b ]I~*@C0sߋQe϶X;bQ6 awcVS<1}]^jovLJ3cy߱<;mуbK+<#Lu}Ҏ筟^}F>ܻ[ ѴEN ksK{̥zWFhpӝ[f׊zVU{ǓEN|+5󫪜rgFQAfcĚت8mx<$3Y;_p]͖AcUdUt[i c>$x蘲B< HG;gS?dw…>2&tR}UV>{oY[CBv:7T6:lfҺڲ,8k|:Ϊ6_U&YX06l۳KhoΒMM:l;YUɽ&p:V8DLGY[15ZA{͹dvq2Fa%'HhjuE=(tu$EèKvs' vINP>_vI5f%;+LO )."dYx i! / &<1E,z.f0q$9-fXu0eYѝfCpǷY[xj$;+A_vٳg1&c}]VWLڪYvI"if!b];#xKe)V+X'iwzp, %a^GPfCV Po-,1 giR@HZ'ԗDyۓ#6$2Ơu+ReA[UD{R2!x߰FVS%  $cKqG)Z˃yLY͋h ㎣6Λak49xes˨ |։j q 6%r2TpNG|~jmbPM*(HDZ)ym P@B`1q S:vaEݹ qrk+N6p_e!s,njePXAcP]ԻɑaBELeN3)df;d7-mRk$@%!CA )Ʀիew񻘎hO /Åk]52ɖ-5%kh K:/k­yܐQbɛmvydxYYMHoZ_[dm;cn;bK*9 dnNVNLoGF?m{&D6+cTBH푤QM²<? =]Qh[sro/W1{ xj2N.A*GՇHupW&L;GsܚJ4WIgi}@95Yѽ*ZKYU4p>%4$i,:EA&בm9d:$x1k^UVU9ǜ;M@Q7{rmwҌ~ןcoQꟃeq^AZ}xwŘopr|[O?Gg;B>UM+&8>>SkɊfJ=5Uiٵe 7TETO[æo~lv,l8*:{8,s~!}x-[$cڽ 8VvzgāT*rMSh[~ʁO _V; ea?1o)o`]zL[!B EnJ]Zܸ70q׏: mG!dNA $iEsZc7e6GnPi7S F=KDoMf$r˦njކZ5(奸98`XL\9֣XmcV*r7ym*miiv+,|jTz o0ͲSE.R@ؑi%cT\a1C;[@Y# jEhem!኱雩yi]grmvӫg>ؓGz5Kfُm. .rl>JjFy2<33&srlo߰6@xi_{GWF}WM?Kb,Hn f`E6GUƔ[\HZʽAe|]K+ٔ[u_LْD~DV~p]\lG休6.wL4سfo&K{i.D}d_?1nXիy1ˉdnK;F0~˛'j峢k]>I&Gw>K ,ոhd6%]6l>ԓFcgtySVil%6wȌ6T 򨳕=eURۍ\Lb&%QFx^jv45mόjauT+y:f=aϙzCrEY&ŗ:[)5őU+GLE" &Y!1%a~inݽkAlB+I lI=\@ ȑ3Kht7< OTKdM6c<[i&h5ن#![9&vnJ*+ŐtiU.k2nD|Suƈc_7k9rFCl yvx㦒Bx 7)3a6D yJj<)Dӌ;8< `܀i.}˪/ߛV!mky-Zdڀ)#rCj"8z b8FGݭ„gݻ2kُ5VCLZS/' +zjm6&f$9d=۲aA"[ G#yCbLoxRo~񁑓g%%Ɉ&X.s6vx#p!%fܩ٨{lK5mK}1MucG7rG~ 3p6h67ZSsvA䭈'pacFJp;efFjRuT.*ՂqdY߿c&yb]{~-ZEkv#yȎiG8۵R8dqd ['HUQ3s+&aZ( 'IEpu A0"W9`K7#6 'gir lkޯ5\;w784dƸRԪia:ԋ29_m&?m,X}_(kX9rwrLcn*:>`M(g(j|;uet~N^6xl#=U~6m a&X/:VZ+m[edϼ]/ڵ*̭W\Odo O&Sد~oǎ kbzݹ~^&&]$L ;m`$ƥ"H-!ygd?A cU}_W6L-d`oZFi'GUBilZwq%6nӅ4hD>`y>XW^4f&nd+mC,1tV$j/cKq¿رvԛ;KfzYcП*/+wݠHc,z^~$9ǹb6DӤ~u7Rj~*S{ePc$OzlҴfmF1[ju6L>Uufܹ^0Lr(t=ajFdaЫ3*s:I4 f.^$c80JN"㘸NKZnQ– p\A͕+P$w<UNV[M6gş2CVVLoU,e#%QaAԌpP cBG4*sF&O0MC"D С~D{݃I$#Ac`$ѰwqHlF/8SYKKuj7w&cJ8 ,js 2 lh^̧YuRX]P$ԭ҆`և,3 j60o?Ny| '"HIJ^M|^s -FS, yܳӕ;Q}Kkj+|8`c,@ؒI#΢ItM[D;^pɋ*U ;3X54t+Cq>J1Ke %W (hE}Vv~VB\lq";S0\](09o),0"㨃P tY6.äQͺK! 1ƱCG/8}XjcgC?I}(ϸgxm=O`˿p:|=Ss/Q 6~ <(́edWVPꙥ2Zrw-bEX{%f}<-zj52V)_;ě^9إ\MG-t/\Vu՛8d[ʼn1rrޮ;=ubEEbfȒ uVփLT7txug-VصiFO9ivj't #?tUǘVx1=fԐ1%ۛBOVy"-9۔ y2'NH*[ȡ-n>/cªiX`oWXm i߫WO~D;nh\}>7d6d 0TOK5-*MMcncܛVHs3DsVuo-pyDy\FlGh*Y+x{x7m|GDlS P꫘HcYx5myOU j֞>N&s ;H|{TE!ihRGim>I69ȃpEZ{|\EJU#.Lqv"c ;UczU坧fkF 獯-SZ\lY+s}e 9")o mH5Epv9imaz?X޳oa9MpG5яwlG~ 9Bֳ_pFjsKsdֈu c =U$;Poޤ#31x{q fUƎVDy0Ra#^=Z(F1&ܗpW6 ;+ek3eZNj7q7{ 7Z9[(n>7Vfo [zm^.b@9+o1?ɩX>G!.?"gn;@3qqv(x74-X̯鷉ć m@tVDd5 ls6r'β5/̫fؗoɂy[K )W$kyT+([a$Eler#1u*%zڕR2UcFw-֧[DP#^(]j۵{ѣB}`>GRg+ 27| èjp~,}B]5Hvͳ|jwx #bpqQ^rJ xoPvBb/,\RVŭ}w\_.(bm+ b%1:8akv@fUV)õg؋ke@ [ʓ*c/ʿeRʼmmX4wގ Fk]XT< G1d<ҧ«e&e<ę8Ɍl MiYlEٿUfեLj 'A5 0f?nܗSZy+` դ|OKzH=W ~BIyc{up\eȻKļd0쪺Eȧ'6i&Z pFt>/4VBD>W wb*^ [ۤ>Z#jU  |<,ފJnuz$;3qRI# r{k!F>cu]}Ǎޣ?%1^٥gJjΛ؏^*Fs:FIjj/_/mUKklfKK˒u[~Dm%(5TG6$߁f0uL/jex`>iOWFUrmi18kpon`Q~CѼx.]vqITEۓ+F,Q(Ɣx(H3rYHԈ{rkPcБHqԁPI#5|L]*8s:dHz, qK\WIXi8nےɐZKH~%/UWԇ1YCI$IsZ< >xğ] S )skА4"DEM @vRE"vd2({o}U}y<ê' 44$Z|BaBF9$xr9L|Hސ ":O7>&D?PA!U|(I wOUAy$n=6@ PwlO ($=̽D0A>Q$`=$z~oUG!#ߐHNHHwpZݚG>sDfw='1n7ͧ>'? }T ,@?_D꧸>' a$꧸>/ۇV$U=>/3l7Op!hxq8sTeEFI?Op}_!,UG>/G SG_o#nd-G<.$̦G(%fm_v,||x5k+$E[%my n['?sH̻aLVMȋwOU</Ncry%̟7wK1<|cuo2>'o\@>29m'?_D\C[C'2y?~$ ~A7yx~'?Q?G'SC?2CfI?G=?9<A[($>'w{D<_՘6W6d~y1ډE;m$}OU:nMď咢Gdއ/Gd!d3tޅ|C| t&ڳ'L:H 4D9?}plO=u>/a olms[_1MuG/qIMtN PL@IMpuff.png/Users/chris/Artwork/Videogame/BlenderBuilt/AeroCrush/puff.pngOEDATAOd DATAd PNG  IHDR@@iq pHYs   MiCCPPhotoshop ICC profilexڝSwX>eVBl"#Ya@Ņ VHUĂ H(gAZU\8ܧ}zy&j9R<:OHɽH gyx~t?op.$P&W " R.TSd ly|B" I>ةآ(G$@`UR,@".Y2GvX@`B, 8C L0ҿ_pH˕͗K3w!lBa)f "#HL 8?flŢko">!N_puk[Vh]3 Z zy8@P< %b0>3o~@zq@qanvRB1n#Dž)4\,XP"MyRD!ɕ2 w ONl~Xv@~- g42y@+͗\LD*A aD@ $<B AT:18 \p` Aa!:b""aH4 Q"rBj]H#-r9\@ 2G1Qu@Ơst4]k=Kut}c1fa\E`X&cX5V5cX7va$^lGXLXC%#W 1'"O%zxb:XF&!!%^'_H$ɒN !%2I IkHH-S>iL&m O:ňL $RJ5e?2BQͩ:ZImvP/S4u%͛Cˤ-Кigih/t ݃EЗkw Hb(k{/LӗT02goUX**|:V~TUsU?y TU^V}FUP թU6RwRPQ__c FHTc!2eXBrV,kMb[Lvv/{LSCsfffqƱ9ٜJ! {--?-jf~7zھbrup@,:m:u 6Qu>cy Gm7046l18c̐ckihhI'&g5x>fob4ekVyVV׬I\,mWlPW :˶vm))Sn1 9a%m;t;|rtuvlp4éĩWggs5KvSmnz˕ҵܭm=}M.]=AXq㝧/^v^Y^O&0m[{`:>=e>>z"=#~~~;yN`k5/ >B Yroc3g,Z0&L~oL̶Gli})*2.QStqt,֬Yg񏩌;jrvgjlRlc웸xEt$ =sl3Ttcܢ˞w|/%ҟ3gAMA|Q cHRMz%u0`:o_FIDATx[[dUsALb.1.y"R G8# sJ/v]aO?KkQĉ>2c@@BYl62ZseC,Kp#mgVm ÐP9wP"䧕1V!>UUnQ1csY&@911gPq!@;RB))%^))jqaF)u]Jkc !n- cb)\/wI)xAC9RJdY1B1C pqIh1dLzz߭ڟNƯ V &/f!ι'C8UUabݾ igj>Bccr嚣\l|ƘˣاO)Y@PQJklIgB"~zfZ+N,k)!GqLU/]'[z_j8qF`io;w!9>!ytRyd0O'˲Hl6iC ![cl\.3:[w2J"~o>|Y<cnTUPőp@=iP !*VOx L|&*:@M~e .] OZΒ;"ɲ,‘Bc{Vm !zqza8s Lk}-2F.EW9f1qYfg2@ [kc \au,YgCW1Ξ꺎 %:HM}iR @9"ei>H״R 0mGq|lon3}iK0zK{8AMX,\u1ekO{Z40Fw]'s? O4/4M<ϣ!=RH@b)n"NDM&= %몪pð]H)o:soocPE#G&tXeY\즜0ҺO^F %GB+Vc !Za0ƈTb  Iv:u?%H)WH,\a;E@e_Vppp1/AD$9(NG۶h&v~TqmSjY[ж-nݺeJg~x\^*tx pIƓ7uu>MClFKks`}}cf፾w]T4v}GH)c̓"I^+91Q1V)1Uk-ueuM;!kн)_30 9Z陠Dmx'%GP#6: ocZau7x7Ck}_#4#57]XZVh|*zNMkIYc*Xk\.e⫌\'E:J!^[4Mc⢆a!6i@2-oI)պB'`>rO4Mk9fr3;C4h;&B;)GX3Ύ1hw}wE[\Z{1v>HoS-TȣڶM,˯-`)r$CC OÓMd O뵵Ro !6WTgΠZ믴mmd%KAӳ)-&`6B1Us`᧮Uunoor .vvvzuz{#@ĺs1kz]Jja`=9;spY{7ob7R/0y8D)pexZ8Bm[/7e.z_w=\.?-f9Rڒ~ PIZ$x1 6.tx<BxyG%dY5S\9/!7ץuzԭ>`n6 (T!8rνa~@zZcaJ)BNyܛ]7Z!3pIENDB`IMtPN IMrobocopOCC.jpg5/Users/chris/Art_Videogame/BlenderBuilt/TheEngineRoom/robocopOCC.jpg  QEDATAQ$# DATA$$ JFIF NeoGeoZC     C   " }!1AQa"q2#BR$3br %&'()*456789:CDEFGHIJSTUVWXYZcdefghijstuvwxyz w!1AQaq"2B #3Rbr $4%&'()*56789:CDEFGHIJSTUVWXYZcdefghijstuvwxyz ?(($ڜj[>}U((((((Ln{=ޙ%bOrOS((((((((vzs] *[;w'R'ZIҀTZkI8w-;z(*Ԇ{EV'7>5LOlS(&q (S:L)*`NiN{P(((((((((()UKUpWl4k ?=%#*#IN{=hEǏҺk]9 \Q팎Y[)*j0uO$ zP B-ӭu_Us1>mYZ:f`zU@e=;vccz8Z) uz@}3+Xk"p`Wq-#ҳ$ӈ,pq JtzF 1 9,1ce_a؏*_G;?zmPF0ֳ4q^ޙB%1sXz-IhȔ1_䨫MƞxtQEQEQEQEQEQEQEQEQEINRf%cRPtVKG4c0\sy+B\`cOj[?(X<eƕ)8V'Q(7¢cTdy"[>l/說U¨P0=@Z֞o{ohe!eu snjU:]N HeŽa -el!Px]{ÿtWԴ4[$OGɼadkyy=Wñ^4 ϴ_(<Gp~?J~ x/:6?.ZW?M2.ǂmRK1k+hBTuzHrOz^%z[V ˌh{a6<۷qcTuKo "y6y[Fݽ1jwM:>wfC. *yRq4F(*[KY/n.猜 -m$EckXP`S՛-2-6$cs]QNH@}Y|Jˠ(((((( :ixFhX2`FHak`h_ҳ&Ky rH:P((((^ctoW3*vSj-2QKIcw> nY:nEV9DȠ/ >RHb>0A1jwW~kT#{W\g4K72<O'w|/.#O<|E%Ni,HDj j6dzt05`qN ٠ MH1m9fa˜9_}WA0XnЫ.z0i#ր6-9zY@QPɁ'-Yp:`a1v|\ů-GQE*#Hꈥ'Ҁ\̑Dc#CH1"I|;{oS?&dDLq~?]Nst?\9'Gz''I@Zw׺@Q@Q@Q@Q@Q@Q@tFXszX#]".܃^ c#\X"MQU #>ht2R@8a>J.OR0NAGp&xHCqXt tQEWGkMB [` u8#YG2#%XH:n-;d* yGZ  Z g̓\gf-<&A63=OOʽdԌRPGC@xZIv$Paܧ69[=qLREː:{PJ'59ziӒ)`TqҀ&NQSS an8)A[ʀ$01Ӛ 8VYx榈$w V+ 3F {1h[P]׀4}Hn۞r?!k3Y_$W +$#޵|W&= <$rFAPAumI5oW1m1v+#  ۟Ʊ((4閖^g bߌnڠg8_5i 3YtǮjj}lٌmC\džm}>ֿMd'5_9}y=y#HꈥMz|2\F70Ǡ?^+vW8jq n\T94RSSjlu5^N =/Y5:p2-QEQEQEQEQEQE[x"Ͽ5ҧ_oztFTPW!~͌z*|n/ cWG]sSH^nݎG,O-Դ]J]/38MXZ|K=n7#ʪ(tBB* k6xɫ.3zs@D@ݹMRSZc>тsEWCpץGs6 Zü֯^L6zұdԤ/|zV]fo_tqpsY4QEQEQEQEQEQEQEQEQEQEf4lί^,7Z̷˕On5!1j"d<$Sh(((~kTؖbı(rPUq]S^A\?)HvHNx}ծtNr6]d՛@:ՙ<<֡~n5M920{S 4pOjE<++9*|wa9hr3Z }f ի{@᫑u2 y׃_=x&}pWL3j1#튐A4Fr9=E s2sK9:@ I^1Hg#Oz*_Θ\e@<4tҠy֞q342|Eyg+| 8Z:ט8.9#{Tax UsVd^r1J)9~V`3=J #q<ޭK=Ud=Qu3*gبg8pyd]>^8~5lPv']jgs_$P0d*;5; }N(wΞCoo6YL¨#9+x)u#xl9˾I#_&[\GZnHx##:!cE:A@w ՐlvWQ8V8Cڀ6, vwkC=tJN3ֹόbP H>7BJ@q 78$)&0qr| (VqV]wqKc=F>qbV޹%QEQEQEQEQEQE[ҿ.3PGP0z5_#]2# gX5n>rGzXހ-p:*gr: UHy#CP p?&UmvzPXև3F?p:#W՜X ?3@7A⭌9ne[8MIn׎*nO-ʦcԑۦ:NIc?P`p: I*t;Y7ll[ KY\9r8S((((((((((,%=W40켞B;F>pt8o(((tr<2,# Ѓ^iEi]E&H짺xv> ;%bzvOqp1``V=ؓwԞ %}yI q@6gۓzeuLru ̙9yc$qɨL09iMA'+rubޝ33ґo9O3fCt 㷡,S?Ҡ$) c(rK‚1Ӓj犯Zȣ+3F1G~,XО08犑G@:t#+P,IXr0ŽrT `_fy!EPEP_O+ z&8jj˴qrM;wpIb?3U]2IBz1?.M[+<A" sО:uȼz a*`Pw8>A! q/>td~| uqYGҀ9+rOLqPeڵ=*!Cߡ:!q|ހ209Wl8J:a뻩||`1\ƴ;?O%v6g\.?9ܔZ7BAԟ50ίb?BMԠݳ@F;U9A眚"**rOoր)嚭.5fE$ Wu?@Ţ?*ׁi?x?((((((Z2U ǁk3t"Ec+s:@U1Uhs֬Ӝb-qV]UX$dմ\ƀ8C\_?x8_cp ^S +&rWӭ,=c*FrTrz9?1Z,jP9| {9Ec'lg3zF=1X:m `pOJƺ8L{Uj{QEQEQEQEQEQEQEQEQEQEʑ[h Aqg"cqߵ`VƓ6c;k:! 䪸r00yAEPEPE͕8gҀ${6 >vmDcD h6*ϯ1~)短3przcҡ2 {Lrqڀ-y@zGl dcsT3!9Avy{bN9FIw ܅19<ϖ)Gdn٤wUN( TހP(B\ڙJrA?VSg)¾{}%aWet1fGc޽3qմzz8*`]ׯO=dSWU-`w犆E_,:rr:) ?.O5 9'eȧ'wXjFlzVFz.2TqfKI;w.dlJMDB ʆ^ nFs_sqc)"C3kQrBYW:Whc:ޟ_Brhڀ3]H sTfӏZҙ2O9=(J~^e!Oz )T >h?X58?((((((*tp1]$G9#Ҁ,BQgTը=z@aPTWb\oҮƞv0cW_Y|5d b+6p c&C \2H-VF*v' GJ"P$E@GQ,X8g@^=I9i_0ޟ?W..N(@AWTa`玹]\r1\چ<jdmOnږ/&bCȨ(((((((((((֛7>ZZ=ո&8z({}.Ȼ;:Wzcq@5Ezw~- g݅|NsrJJY`A6(W hi^nZLl @bXý0ǡ)'@gu?M!}E/C3J>3K\ @p@*7rtX?!P[+tTsTy=w< i G?!ң$G2}(2زIuw<9*ZA:n 4a u ;Zp8=ҨZFcV);8r@=1uӼ1׎T'>8<V1p1:Tնt׌ڀ0,C ?ymϡیd+װ)c#޼{[YlȒF~zm=PymS//9h ){ܚ?:#LPc@_tn)$t? .6O'U9cy폭;%AҐxr:J'O=i1Z\n@ 瞧4Ia*=qӣadր )lTʷ~6lP}IizMgq^˟.&G$Tp?@hZ᫤*H!$8#>ƨP_S͞?%>yfмٿ.sƃ4LЫ+椬 u8P1괊MNXc W}KB/ݱlL=~`zqU\pp21tum)&k>;ZVsyXN*OL=꼉8o^⡔qd=hi0#֫81(I8?ZE[x?ZpIUӚc:q&F\dp#SA=ȉg6.\Qӎ;{f15pOy=8[`=Macrb?|zӥs~`idL~>RIG tPk=miBb:9#z@K#9+R2ָlls.J-g\ӿ?Wʜc+?!7b{Lc@ ӽQc8\֭}闩Qހ3jc 釦@Rbx@s (((((( /o_?1],dc}+ІoM[yr x'񪰁T }{ք+* jҁq}EyXd6Ѣ< 2Xl=k&=pG|I.>#qĻ# |#3^d /JN}j4Y'$UimFI=1œAJX ?ZB 15@ ǥrzbsgCЂOCq7'{/C7YD<>cb`J( ( ( ( ( ( ( ( ( ( go=; YMk[tU<nxz-沓`~鑀ivj>3Ai&g]K?$K2N1Np9;wRzE (P}κމwBK;Hu׳)[5Fּ?`I2Y7^<׉~M98K]v9V8={?9(/i͕e<5<wqU4"(#>i4dAڀ*6=ȧ9;x|NdW֜u`G۠& @*{sP##O5q`$t  t9 BGp-毭2ٱQfr08?9l[=jzq,>\4džp,RT~8-/01^#Ӯ!.= hPqFF>_ c=\ 8Zz0=I)zc8h*3קL"NҫLw=G5q<r:Tr 9?T}9>^-Ktڭ"9~f"ksj!6UUA`mԓC?*i -tϦ^n'-avXeR  Q.5 |s ^@ZL0*3qG+ O~&G9+Sf:M,rW rs@ ZFN88480}d^uV鶳k/F1>8q|vKiH&'~p?8CQ{Z|mޘ^{QE|٫|3 Ip"BW5Oa4\$T* yE}jqҨCsw>7G*CFA$NI gsU}Oú}:8$P=_|_6'g;vw&6x#sY˧&J>6;7Qlls!n2z/~ qc4B8\cn~:OqazAu|6㮺MsOt5~IFxqߎhCpx0qHp 7,:uSMb8 VdLs iX8'W!e䮮ŎI;7QC?\>?/ WDv+<23M'{[׊S Y1 [H@3Y7H8Ҁ2'GQ 50##g܁h @IE_O0#\QEQEQEQEQEQEi?_+r ɮgAm?WO hjqЃl:`zn>jҴMïzn3Ztc{hFO=hKcě &BW~YG^m>7O"p01*1אWg|tGӵP>i"ZۑԌJhN}h1a$/8*x`3v;|t@ WB76{W jV 1hL6zXZ;$ٸ?Z#K F߶EcEQEQEQEQEQEQEQEQEQEb2nV0ڰ-˲GI;(J sڀ4h9n@r{e#hۜ Ձ'v 22Hjˉyd?J $HCWI!*̡ZfNNs,N {/-U-$@9y5|WkN֢;ByяBG=I!s#WPm'\լS7o2trVڻm/iKJc'#)m 䃚[1*vJK"y2ipqӅdPZ}*x#ҴDvj[u=PޥKu@ymg@؜s*e9qۑW9`Ԍ; g ROj+~ [!*M#y0q?|ɪLY;d2 /coo}G=&soP@0Ӛ88'B5j.;f38=)@ =2y8`KtDӊ98\ZXkzdJM{ƨo(W {WOza>v t6s_7o6;MIAl_Ϲ[cN~s=HȨ{d5^;MjyZ܌OM4hTBzzLV1F ij޵ ߵ4P;&gڞmɵ.!$,99$ mA5?9#KM)|(`]=q@L  vPvTܒ2+ rA%cvcO鞔4;RqE|~ ¶<5i6zƐ[9~+~P)(88V7l֔ɾ2+?n3s6O\'-u.趠 2w?nuF*>e?.:o߯#d"RHJvH<ʀ-Ƹzt̙R ,G :F}(6e!*ӱ\{zU7T6H+Z@1m r? lc7o˂sk|d??\F=o!}uA|`ы_J]Cz@#o@+&'u*$Pqgd:ػ qY7q8?~]qsc.TpAt湪((((((~g J?z}EuvPu۟OjֵLך϶B\zg[6nu={9}۶ΨFHzV坰ڣIhūޖWXa@?6Q'.: ğ6AR$qsD:bϴ984=x&+x>zlT+}<xg8s\.e'k-ZE 3`e[^vyפ-xZi՛Z 6rր0 Nzx9Kɯ|1]Z[\K E)*|jԱy qmBQ'@֤X9ֳtڏB]g%P?IK4i$edGPU gl~BEhi-LjKNN-8'ޥi2Kļe. 6[02ǧj/x asSMxwL;%9X@3qYWٟ>9+:Ov?Dqz{UjEXA9P}iq9"nN'Ҕs@0Gm^0qՂ98 ӯz(_6Cœc>}-*|_ Ѡ@&^{yh9{<Okʹ,2`x߆U{ᛴ2[2[33<}+t-{N5Me.03?Pg£6:V[oMFրH'k~g=n%AsY񆑣8zpFz9JmۃQB#TQ<Mq:ċa8qׯZ寵+JMWNrH @) t\^ci#PV$sT0U qGLk{/<~r晆pHrpy?5lq@M)NzoiN뙙Z|p(\97x>d_'g}q\ƉxN @]4/F-}Gw0z^@Mz"-}k5srb/ 9k5,sr+͙c==pXr:V%e1i0>kԭ<@+_$ZJ;q+(((((( ? ޸g뭐`s\<i@-F@9QO)8"$*>_onp {x\qեrH88hCMŚq8Y1uמ-eml#Sy9)<<`qU?J1_API1`J҂!$ǿ5 N8ɭT,7c ={ #xb]m\ 8+6amWhzײjRϖA\F9\dFyk*[FBv󎢻k?c\@QZ6NnI*xz(((((()ʅIɫq[xqҀ I; ZH$GB(XH:6 άƧ+М`VFpTL@OXއ4z,199V SLA#=*OOڀ/BÜ#e9\{TryҞ&!lhKN=*N}34ܜj=k]^ǵfIt`rsښH(D\X\~cP#tCN.,48O N8^w^yca51JO:q^'c.{5Og=AV,+?nߍL7cpyj?5[""$G8<=Dj>Z\I&/1: a{j(uEy yLzpkzovJ qŽ}QEW`9%<D1##i[e0v!ʮ=+2O S΃zG=GQ{M?wn.] Ht>aQl 10%sVujzu^uo[*#q_ oZ^cO2h>us#gjHPzPa}Eph )x9Q^9=Aғt@ ?O ~''(:4=Qȋ.7ݪL';PG wJASZG1\|ڀ2dzw\Ҵe'%jѕ8`G r٪SiWuO2:b1/<ucRR޺#J@vMkɳ#W%WG@J$ɾq#<*j-#5>ͯGyφPٌXZ&W<mgTf8'4f]զ(R 'b ?g_{=>sf"&Zw o LqԒSjǯe}C1R- b>{)?1:~ˬI8 m:qߥOǷ(,37Hp3 ?Sm}l`Al j`??d.GK{ _E c? V d.#ʌ5 CQ}pF{5?+ğ?}@D0>_|ȟ|CYm"frz*8n/! n{Ym<1OxZO +3ZPNGsl>Ӿoր9t}hCb[ lA8#ǵVՄhq֥0#?Z{ѳnP_$p}*3n^s+Um'BP0N9a0>t,qb{t>j)4jEn?'r+,e-s5BFW957#@ czPs@NXFOlO=Z bsP :t!8;yU#RJqN=OqN'9xNƥFW!<cp.c1xn+Tx gLx2(I^x֫I?{)z;R'=ja?Ɠqs9idt51қH r2|Tyz.Hg҇g+I8y>#@/bpGjڇ,wⲬSV@tqAҘނEAZ L΀"=qt&?3֧A Υ =}G|\q~k>MNsTr:V*+\,#SGo<}1 t*:G5iOZpcM-B) B-l-ev2C/F#;?>#e=ώu[k'ǧ!% e wsqrנpI ЏҀ7:Ij [8njbxph9 /{q߽ =x'8.yȦsh'Լ-N8#5Ac+=r?~!\VG-}c#c|g7GEmr^Wh7\JO+Lig |v-ǜ= Dcր(`@ _>^:P1osNX}GJ呞,C@,S!+9>(x @;瞿jwσӊQpEPAGNX8=ϗJPV!#2qGXx:iI3=hPAzT;0'Y c튍y= d.6x'n9<T_w^-Bj ~{v5H|4Bg +ZUۑtTP͓bMdRx8⨸t~2^Bh)>e<wS}+Rx7f9@s mŰ֤#zG`Jǖ`IqVӨ' N}hHi` ̀ ֢hFlc4bL;9'5z2Z˂1}p)O<6x -O\J~'(PcOzf07;SSh#iX*=9㜚wa@c$ԡ SG?S@T;Ҁ=NT:>T193@l b`P8bsqڤy.cU8aǭT/CM(9N) hub^T6sǥ@8=:SԎ;nm$q1PWHY c #T&c'5R .0N2J`Yk85(q6[kDщ cvH8?Rk\$„9) t9'XQEQEQEW_S?ZB>Pcs֡V ?qPnJ9QJ^`5j/ڕLgߘ(ʴISknO1XfN29x39&j=u~^}*`xC('\SˑZ|mg]N' wo.0sj}+ozV_8GZi F388q5Wƿqgk\']ӷ@NU#cӹ=j02ހ4דOi9=1׊G"@\rr895 M1jD #w5?V`rxu4¥5>00$p@s1M`s(jd$hXqs )'U$Qr>zQVE `u@gt⩺ ? ^t\ ֫\8@'8͒9?Ϊl+FA8^To$0@ڞp3R3? \߯VXA'ހ9Sǽ@=z٭W< zsU%J*N?>څRNzթ-Z3,q9r89*'sڧTܼd0<DM6;dLs>,ch54Pq98B s2l&:6!CϯN>U s:f+|2yI,}I'Q$xsۯcP ZxRM9'eN`{'>0i'$;nIh9R$ėjC>0 05HzHda{\C#Idw44c$P>)1LD'# *,JOyUݒ8"ps \zb H8p{Ҁ4f;qR f1`JA2Ϭ\Egԗ2 %g}G@Q@Q@Q@}<tp?J¾/JrҤ8ꪸJ1sL߽(p8|N =h) JcD<}~琅nH~ lb{M 4?5~H@}ǭtœc=8湭!1}A{\2^` 08U¨nM-;3@тʹF; ܪ{7*B:e^~JN~un7<_gH$2H@903?rPKJW/iB q_R%a{O3@ ۓ?!?I*NI搌drgu4>sNb8oz^GZoO T~o^(z:fP`PpqQ8;޴Nzi8ǯ'*88G5VU$P+}H5:!pq}{pZB l}9KcF2(ؓ#0y8U̯˒;Xg=d$?_Ɓ&H'z$~cP߷@@,:Mh'ޡ/{ }p#jҀ3h(((+OOD}cRӤ[Z.n K 8C_ߏ'ݨU*Nd *9tIi'%ۘ9,IO :62?|'5Gߵf5l=@|ӣ*=}/~.\W/f,y@g`}}~@<|)V:fc-gavXrG$W iM[Y*"vaR2 |矗#nH/w>^OEeu݌x|Fm+[edPF$8xw{?@ԃZ>Tdg/s@/S@^Ax''D,,'p$PFU )Ag#s"ǁh9FݼzRp=i0K=G4}}<<Ԅ)JRw[ހ# ܞi6O 3_ž }Uy''o֡CI4r|@ );o89㚔q{,p āՆ95/Nھ^ )r=r}RhWۀsf>kW܏{VdxoCLTlNO8o!y-χ^l$ֽYA^UFkwg:lώs]5\grGt@$WSh@=ir r:Sj59PO?SCyHU^9g玟ʠzT}GVVLV9A7,j1z}ѿv l;bUB``ČEPτ<_]UgncY[TqN}Yxv P G`g r v $f:unш%s33ذݐSI$YvoX[ZksM+dGu~i@ϭ(jn=V\?:[+?#A)Nq׭Y2w7>LqirF{4i5v*ڒx<{I.y ޢ]M4lF:]q\}4$0FBU@$ WHWs tޟyi{dDx~s/ |sy<ۋwFsLNͣg䅪ǗQCP `g] SoݞsZv q5R܌i[1<ր-"1V\#~U,˩Ļq$>; iy+4)\1c c;WGCUw!Oܓ{zN(-\pvϵ59;d֦_OZnϛ ϰO flG5igj[9#*8w5͞]CL=JO>)$tҮAj ^G%~er{~w|.o/gEB40IڞG\~*<}1ٟˠH+Ϲ9~Pbr??h HTG %`XrzPc~IE@why\Ң'ps$3.O(|]XLhIw<UϹ:Vb{}b]者F1s򍣎G(}j 'aJUw=LsRFө gZQVY\U;I?OYrGn*ms'Ozn PR3׿J#>89-gץWv Jh 䎕8֦'$('8R q@\8=x,0|ðTLs@϶{{-teԮ |9ϧ`ؤW(d*~sJP89:vE$3ן=T =qJ2y9pOL.9 '9gvsr?/€#>y9Jo`()G,GL }KzqO 9A=40H_Br$duQF?t H;>ܫ`ҀwM*0IzB2I+?3ր()]ͺ ߥlNgUc=y ~hzTe@ci\u眞Ro <{sLUNC-I 5 99<|O2ƝnQ~ӿw(9E^էSmyÑ;~>룇JӣQs8:p=zK;O#8ր1yro^ ?zprz.S'ԟJ'*0x\x3ޕ6^Ue$u\3@5CG}֠SZoBA3;gNN>g${ȸQ?#7zi1?ueU&Qк@eQ@Q@#͚$QYQP`ܒ3Ҿ|Rm^/ ;I Ơ,죦:$qߚa#U`æ F 7r qu\xǽgVc 'Z[ў588}cz5}u+Vx'w<'( ǥe_pZZ=V(w μkş- mQOBZ}^ۉo.\3$; 8=^ qV%r=Hnk.廼nm]VfsH~AZ@£=;Uc=*8 dr*3 VJ33֫2=1m'O:VȌr;O@dEyD*20Ñ{zMtlH8ӀzWCip$]94Ye0G[~5$<χC{7_(y#d{ B$zx:W ϡ 5>t=M f:goX'ϊMzJ湟|WA7_%S|#a?/IYbG%~FHP>Ԁv9JUb܀Tg?8 29Ⴃ83Jx`tv#94{ܱ$G(,2 ;T ֗}Aϧ9VQ?t6!2ҫ*6ƹ<%>ׁjƩ6ilDb%O:lwU[IbȅFFv\{u('x;]\pG^ 699<⪹XӯS6IeoR0MWs?íLT8==yg2ygƪry?{L{UipWǦq@1 5Y}oתtPj+CHdȨۜ@!d~9\?:@ qF /bb p+8 =+W]FdxIL??:r "N?Jz`8Dۓ:v.c~fR?{!q:prxs߭DL1ߥ&)=1C=sVׁSJ4oՆ(P7ՑܯtzPgiז;t/Ep׎>#YA#<>)OUېsjkzwe08$PIPqFyR1E#ңR鏽y4#<񪳱`79\{w.0qUZ)%rs^kWE$+ҧO~AV>y?PdSO js(XUchFzSLJvc=b m<8s@y+zڣe֮E{s1J ?Ҁ*l q) ?OZc$Qi,:&OZhzc1М€Ұ/lcUܒ)ו\=_SЏEPOxGh:Id`r#2ĸU23k$N5n(?F5n5 "\j>OC=[A9@miDMtP]%a#G|>Ɖ-͂O_OE5p@#{PH^yz}RW8:nB1;TŞiw/ oDg0W9|=:Uyv;|'IYp F'c \3g5@O^=*o-bz8 IS|'bW'/zZ^qǭHF~#"۷=Oz~')? |Vq0ϥs>a%N,rW軯gԌqG?^Oq֗n i}3N8>6tNjG^Oƣ_Je@,n,\ ׇɾ4]7ZjH'RPK%\`NK?F>xh Os^:SL'g$sPc3Gt` ]SCLxxR2:u%YX`:)_|(+?(<`QEQEQEU {)/= 2OsS]5*ƣ~4QQJ\8GqUSqV#P'A*e_^>5֮ī?ŏʢEzc {>&㓌U'p'hޙ4 =k ]NCP_kZ#eb8>+1v,ijI&=#ৌƃu#=Ac,|xq'@ }i7A__ h/KpڍyW;@?AGd6z REd 2+ѭ[#+ 3>֒?J){{W=>hO悾AB0΀"+qҹ~,Ȼ/]X^==}OB.K G9+[<N|[bG%~#-NAm>ԙ<;Rc-ߦ;q88J3Ηq_~Pr@a 9Zwaz @ piA}p; pw7Z0 r3{3zP4 r3@ uAyn9Iހ9H\!ޝ8'4p (\yt64,;m&0N 8)Onԭ=H">(\$817 2Ox5?O3?GO^@nmڍp]ѲN#Lo0kǿf/˦\hFŅ ǖ'H1>-FG ZG.ڸԃ ;u2 )jqĜTpOjGm#LߥWOLm+c?!$P8';Ҫ3#*TFsjJ~JJdO8 ?4 #8_vmU'ʃ@9SQ@ 5g춿d73'ӊPjw9>#?fQEQEQEQEQEQEQEQEQEzɇ'Tj- z)rz!~vs(aL1sN>%CRg F};9LPN6>v)fVgs#sw?(OX+qvINU gi( sGiT1Pb8杻 N6ؠ 7m9Ry9U tX ǂOO+&p}s\8+<\NJIؓmc t>XzWkkoW% )Kg\Zbz7;,@3pW*eQ=(8D1:Fd: =N84~P@82As((U.@'RVy(&zz#M1#rǷҴ`X-`qV@O$zhzu5acQ E9H@ Y3]xJx8evԞ«I'ә?.}FzVv{S> S"`?q{ <\cƦonLj=*QE9%3&3q9+ Gs\uQ ,R(tt;#5hMoqFw|+ƭ>tK\X,pAi*=|׿h@q= ȁ0=(*I&iz h}h-W3Is%Os[藠L?rW蒒p߅R%a{O"L#9O_^ q hӭ)9#HOlB( ׾=q>1\f?/;SIqGL)L߶@3?O_=xE{s;L?'GO^@91"K̇{>I n߅9e8eku5W.$XA%_/F֕ўZa>YCs~ր5a{TR`8Fe8=1뎟s88~92^ :|^EE&szf=lTg'ؓ֜o0.j6'h';G>\p28ZeA# Q?=GoA@ GFR61Zk}@zc5WRLY$c{`U-Q;&2PiB09>z}D׊T8<'S1a\sO^B.1ORI_\*RO'~t @onӭ\i$yܗRO.7|]}mbb$6r2?:(((((((((Z}}ª՛_q'ڔqtޔ= < yQqR3@08˸*kR pwGv1'w<~ \Ev `4AZni9=Gֆ J#o n1vV)' Ad*P'C 3sSz$ p]Z$L*xLvc*g0?8sO;itҕߖր#1 sӧӒ=jR6M\ tf;1NbG1 ~  ?szW56B!!F` qWOGm{03JƊ(( ;H uq,`N:N,+=Nؐu3۵JSNXqN*dA؁@s@f}9)@ITkEGV8hb%!GITgƬ]Ƀxco ?"?fгWv$g23@/J_/iCА= ~w0W/iCPg[^ >"19hm֩`sG繧H:O֗8S Ӂ(9Swh>MLG@8#'}^xPߎ(h(=1@ ׌Ru>gx2IhsIqHǞ Zi<,J~gz,1x۵|sbM?*nQ. [O:~ዋgd1`P  0s#y5|/B3Ѥ\Fp8)#ay$#1 pzP,9PIF~be|'T0qH/v!.Fp:t>/hJsc*@9i=ZsDgsxlw޼) ٤mJ h%Q@Q@Q@Q@Q@Q@Q@Q@IЯ$Kv2!Bd}+U~iT]B2+smvA1ހ%C#8M"2zz{Rh 2cL\y=}M2$<TTQ@v>|i:y+\uu8e c2Cqt>׫Uocidr8r}q>@|$Jr#^Sh޷/ʅ[A#'Ƣ28w@@(?/+L'Gz r9pn 㞠PְCZL<9S,m=zJ !G&ʄ}{ziYG?үQEgIխ#Ӯ˚ G :G `+ qY̗vn)fPƲF3gmKRo>\%̀tQJWe=G[Ԥ/oib.HUU8JO-iB:=H?rW"=@sщ C䷧?稠insy٠l 0 ".j//MJ"WEPڿN([1tEgʑ(S=IIcӠs=W˦EƩۆrf,PGliIG=%dqp6}~vZҮG|_Z=NG &$"#=+i5ΞdA!9;O_ ջ'@&>:1F92 uT<hxfY0zN 6U&pT[jU(=Ͻ^4Bg# Nih;hzT+;Sn;@(N~uzN@8p(^1pxJ0+Jw|t1@R\:pR"GCMBX) W5}3Ӆʒ sC8?ZGun.m&he`<R[9rBAQEWIPxL J0=]6rLJc^X`~`EtRx91Y@Ɂ)3}TIxQʢK]C}9;8QEQEU'I֯7Hܒ~Oaz6vsj1!¢>ЗcF̯p|w {(kF=CgA~gcxx!Ʀ[ c@ITz@IFh鰘[۳z^*|G }6'nbhDl1žHMvZSy$۷ sۼrzc/%Ƿ`=C_^߱WuռA\;dH.XHIy8'e_:}P\i777$"p3|)E}_~ 4KX|+ YFT)I$5/ ${/&>4oxd= ~'oeS#`ʊ 9C``0( K٬9v?Q] CW"/ܚ924gf#a?_ТS:WI o2:qv4|+y?;ɶ:y^$6:eg7 z 91Н06~6f$bLg}9Gf_c-M!C8nǷNhh0u;;H9:w=#'44#8_OƑXg^/7=OqKmtwdz])o˂rx9ApNqϽ*1ɤ0+>~X.33Q$sG?N+}=$mqt0>=eSǧֻ)^=kξ7?뜔TQEQEa.4EsȯLml&GhUQ=*Q v@;P-جwHUxfLA"`g;|v<'½d{v\тQ s]{~m6hd8 Byp9ݞzw܆yPOy/*arx13:p*_]:-yk!:y?y/H(li 0ysl,qӽx=k Gloh7Ks\srS4^' e%d6;3 ;0uvڅmmd譇vqʮ9+Msߵ-kBJ|Et !xwQ@;ng>#?^T"P@UksQ)<+Zi0T3`pYFFIh]ak5[B$LR4%I>|k9m͌,mlÂ,à lŀ0>+W>-x-IHZ|lLvѓyI >G?rW ~~4?-iF8Q84UI鎴3Sg kh慢e *fKYY}^:d޼ƺan1F8S1{ 2[U\I*q;q֪iy?Z\HA]/C?Ojn<²&\ݾqv7L&Lى''zTBpR7v>P8,ϥJOsq@ {MI*8Sߠw*qϸsNx}(0>~Bj8Rz֤@Fqր<mTKI~X-^M-o=u _=K1$(Šid!e?5}+ύg_gz@F3) $9H,\pIygo ] xMK8$AHdXC7P[KyqO>hg&P]V(=9 T݉,J=3vk#1wU#mSK>1P'hTJ~7Tl,0r}@ GJ =p{fyNs= 渟¶洒Bˆ$+ovq'>s@|u;6 2>0?XCw t9W>YY?Z5v'~uFFqާCr?:㍩>>+6JNvs5hp,P<(}0鴑YZí;- T'ˉ `3{Z4z5f+Ea?#xbC-llc6G t_ǹ$I$h*u횱khsK'iLG|d]0Kj`(,SO&O9$5b (j_PD\Zԉ)̌271ph?+:K2Tm,?3Skh->m#U Ͳ̡Yr;si7 p8=@=2+V #8ys@3$e1 QLm9}}hK\Q}۲q+j|i2 |k#i$2;hYeNՌ#Ӯ*吪d/50L`` ϭ9bN׵H2 d^ÁSzsTHN F%(=^#=8i:媀#I2I8Sʌb+ܙGsu=k r NH9eu9(q ܏^Zy6 Ny?jgbNi; lsר`Q;ݾ I1JI dLK@8P?1${bN \f݈ < 4|c Y0Hv '4JIINC’Q)ҌR>zsUpZviVjI# ך#C"H 0>⾭{ i,eEVWВ1vW#F_f2袊(>/O_E ` ppx|ǚ^?z7#P6Tt?h#GQ r=MH998^)9_gԜӀ`p=A, w֠ f\c9?\;t^omrPEbͯ;sՈvVp 8מι-_*sF_]DR9>m9HixM$Sz~gT61{l}~56@4HH; {,l9q#cV6{TN0 Pqګn>Гӧ H5*T+ԨI㏭Jc8$DS+Ϡ*m_Nxa^hVz>zuH2RpBW⾏kËi]ń`dpv0@=e|b|(ơq4gT=:͆<*;X`qAhύ8Tk O8#j$a_u5\$LŞG'%I$IzYյk/&S Ϡ((  K<}++v68pkA_cܞm֟o<.h՘`Iz*u$QI5:(@RǨ#'Sd:b$9}O; r8><qJ0Ng3ϧJp`P'=OLS? F>ހ^'Δu?\=3z;(+qdc#P3SIu\C.(F'7NjR{gbNp;PpN88?Jj0=zӰvp{`~\v@O=x<Lrqvm8搜(&utZ{i=ڿR0I[=:(']lr dC׍WoYk'vmvݟ$gv9k(( Fyjvp9S?Ȃ2<H<K2m5keRX42 AS"Ve{ŰX~Y9#`1 UTy|9HomfC$lHd0#K s^hH -1~ֽ1;I=#UWRhyѺ€ (=WϭI{OXg~=@,=} F9ڞ@NX8g"#IrI5G^җZ/- FUwqIǡ֑BH+R@9?stWMIW'*RE¨$!}+2`L,F}3i9鎢/GzsK@2r{Mp;6s;+?9נjr0{StFszGL槄UzqS!#@zT}&sZ0#Ҁcܟw!:Ƚ?AEPEP^ 7:8lpy~kfJ^qץiFs ɀ:}j\ I$UΠA\jր'Q+}+EZ83T3|bԤ䓚L43Tlw ڀ3#MoLE2¸pЀLc8s&N0x樥@q4ǞAzpWx\x> &?ܕPW*;1?ȖvIیccހz cӁQb3LGxWj9&V=Ty'S,7>_-q#tt?j ʶ\a}zZx< =OCV4=B}h P9!'8<`7FkC\&u㜸d:@V;*hp4D TFpx5&zͺqK\86ϜDH8+K+qjZ ep$${f_hw_i}YmehLH# &C.}NUD׳Ψ !AbN2Iǹ( !֦O25i19 ֽ ~h\j+4U:1dG/,5Ask~bX>tWڿD-ym&l9BlWUG쓨/57pj|6Ɓzߏoq@=EJsaQ"LP#I9')(y`sȦ@uǯqNc< /=(>@$4HlPדғ)yz*í4u8jK?Bh{J01gyh0nsZgqҁnۧf |v?CI531Zg9@Zm? jc[Hs#R} O=nݫ4m zک* 1U`?tGԼ>.|o$ |)!|_Kj1:;chf@B>l01k-*3%#A'Z? ®ig} @_w}LenHSsW#c#l={S$V*A߽^{`Tr؛1@cMD`Eg8T"(CW" ?­:blܣ9Q#ހ1E?QK~vQJwx;P:3T.y4ꃜrkec=F*exacFrOW~:l/p@9y0=U8Fm$A=ARǷJ;e8*G#J Wa8ϯ[V3*g9*8&&xMvpqss繮00(> p?IsLjQ@>5Ym-kjr~co9qqAZ=^Zɍ\] 8< Ǣ ( ( ( (= |^o.q'9׺%9׊w?u$Vcu CjzjnҴ߿aV&<x.AGs|iE<REK_5P^!WAYU]y۱}qsg9o|U꿳.6b%FMB{iKJC.WQx'>Ϗ`9ZB:PqLS'4ǵ ;Px_&ӓR۸0:cҀC֛s)IYTm#S35FI#$M#G^ic֘(6q^OMV?5Xgdד[n6ī!>XczQl-b<%iLFm eX3.8zq:M滩[X[8$(twR{dq'R$}}V>fY^:qvp|!AՈ{Ѐ=(>/|>"CļBҁ±0\[i=dAU.:V7}Z-?O̙fn5{I^fC5{I_hLf/l$῅ }0Sv=$W>' N333@7>e +!wrR dx"oxF7Q{oyTH0,7g{7pC=q9`FAud fO@CM+*3ņG~诣m@ր+%qGZ^c(ҵdPz`is9H=9n7u}<1}Nxd\BP#e9O# B'׭5!pO~ZqPzOsz~*qIr# ߳QJmʁ~Z/ONA=9!t<cf WZ<k>-|d:ϕpR)8Q H ^P:jhQ7W)㜏Jcp3hbF>9$gڀ+m =3Q̘3jO S.#|c>N Μ~!%4cp/=j4PqR68zԛ>Rnx9@ U#Ӛx(LҥT9\8늳{ߚT\ҬҀ$p{Iœ U+棥qvr+u8o %N8,s#ǷJήÎ8GsY}QVbEמ)ϱ <Ԋ$`^A\z}+?/OM3JNGi7bǿҀy= =:Ҕԙt|AGC|w^t)9N{Wi `6p;#1&0sDpz&S;d«He8ϊ'ʙ=x.I?A@\`7s*ryO={9P㎽9/yz>ie2>qאףnsd/9%؃o~QEQEnQ@^\h}z,?zݯNJoY}VyaN8麽.ڣ<z }LÝ*lT1wmtqn2N2G~~2}K:V`/L'?(cK+;72B#$Y$yi$bij3ORM6( Vy4PҪ+/<*=COү$ʞ +Gp?Jt~ ͭOvkjG"Fe&b@ vEV%HI[ /pơJF1=@= }@.lCDVz9:>>!rvhr8ܧ ~`rkh(((׿gHZ[)qD±b9({sF\׏~& #Ugϝaعs^ր.,q2j&yf^yFz3=Gz:W؆mSEK_9Woȫ#мe%#_/]o=FKyd}B m)#s=5Q@0=qǮ*eL ҫ]C{mŴo2IpAd(Jr}*Q\5c8 1zTld ſ:^6ѽ%SFxtŘ p:NyVuy;l$Odxx.{nm:qx :i1b2{wRY@:q碃=a@(Aw?J yPqR1{ B@h ,q3:R}1]fU|bݐ=::@-𵞁Xg6EfxŸV+ !"LO8lv^$7OrNp+.QNpp; Zύ/>x"#}˘1@$aG# }P8)qQiZƝi}i/ku HތpEYeC59}si̡s{V6=Y;Zk{C@ 8=IZ! %8SZy^Uqw=cҀ(8^Z6.=mkY ?<:㿏z_%GT֯B&@mHwv qOxUKHq.~Q=2I<xHZxn62@';# @8$mvR{n˻``dO¡ ( tuO@~@XS&X~s98L8wVϔp:s4#LPu'QM#zzh^ǧ~)pz@,;} 5=x皶eRs׵d*RRdRAuU~!`xJ. >HD#9UO?t0zcץXcϿ y֠(:g& ]M!\|kNmad^GҀ&'qǧsH[?4g !8F?ZoO‚xlm3˯KHu3ϯ,k`p;qZ̿h +L>r>? |@\󞞦H @~ Ui'P8Upp=*p8Ȗ$Q ,P9$ -_V0VQ 9(CeN=o.忻w_<:lu8V傸R>Y0{{sW'Bj B=Z[YpJ[G:((z>qg!6xuAR ( (=}־w6%dU\r9FA*z4Wf>8x>{՘U^ qj#_m֡I&݌qn98ļsh9:h<"۩Lc?~Қ!\@9_ړoZ^z `J\p1юA8iG94t=q'9 >'{zA݌r?*s 㡤 :nRG8ӟ#PHO›Oǥ7_Zi*FKFСҢ Ud<}֥P\|2 3~qs]71LnJVqۥz&ڬ" QޢUR=:@0{Gz$ھz3ɫ]C;Ža8=I$9%\n#ǿBNqvᣘ(fqFFh*.;xCR#s%g>mÒNs־uq5dq-$G*{_PMLiW0AĪ@6F1@; *Sx\g=*.C1P$M3QH+?>6| x#4Vᇝ9c^  9yBk~0sxv YeUf7h~\n @΃#R`BZF۸yy pk?5ψ:h[g`7nC@91FdwDn.:KIfIrOz(EJD$Ud=zMBu fk 134UcFЯ= U׳)?Z@Q@7_ ul]@2ykPnK"$7?J >,n>*<A>R2N9RA䞠uiH sP}^ts߿Q5=/΀1>OH❍wg=3N(6zfݸ8bsuXd qN >/ )GJwNsY`"bUy&U\FޙAdVFq:cV*vR{V ds(׾ G] 2swg+n砮|bn]ǶֻPJB`uN} ܑmQ?:N-/@4SGCs8bйsɩ SY#k}%6~¡uS@y=^A,0 \cjiXwy9% ~FV9L^ <9ݟ|WW&78+;jKo;51doES8|zPQEQEQEKkk%K?O<jY]41nV;}=T.znacAy@dZGMZ6Bp3F'8 w`1GQjNiu4hJ7t8?_}[ @GNIEixsFmwW+/sAPgÏbd] vG8fn.9\9Cch[ Q$9k~vKH [;խ ΧHixR_7# \ɧ񖅪oYxv,c3:!֠ s88[3 2;ӡ,9ozX2vg!zU!A?qr9,EZ*(&E#׎HF2kݘ9^S6|g2-'%Qq{} sQEcO5[ȭ-!i%m?;UzCb˒5Pr ?s87K9t#OIooLIRU@8⯬ 0587* Zd`z9뚖9dQSEc]R'Gfe`|O +7:]y^9YPA@ WpBm^oXxH6w0Z灈>?(RMMI8&8Yz:&$u +S/k'bӟmKfdB\#fA98u>'\=zT9nhGޘz@JU]\vA8  ;vc(=}iGA4g:v@ 2h9(>ԇ@/^2}i8?)ut tMۀ9 0z }i|q@ 'MO7]"n|c 4{RwmĝI@IIW_Υs+ y͉{RpTw` c|K|@;>aakkek y arI8P09$Mf~ ӼK`ze7-!l$UlkMp3@d{ |1Hn 8B~'E8=R C@+zաh\EԂ>qmPEP^w]ɬZѐZ0d8J(站 MfIq߃AYC9QO;}2xwx =_KRUѿB?Cۊ;M;T1?h.a[Ld|&plA g'_˵fNpTh`hg:@I:oc##*2bxďڕ!KBk\ S.&3F0O]1{r#9_tx #R-8<#`XzQg4s'&>n]41rNTp+~.v2vg%SpP7c''8x_om:t=L1?d cdv(J(5~ !f״(scF?zz>_Q\C5HNH׊wy&p3<' R(Ge/v;t/#4xv!6󍲌k]*FvȽXv`{ :s>#嶽ey\CGU[Io^6H>t.%i6PMt;xVɌ]c8y\dLddy8Pˌ*PNxةQNx ?R{0*sלUP'=5 dl1I3>R1{s9LW5 /|ys i PQwh)>MU.TbpMun-->l'@h\>#_?WOiqDQ@f?yVGf( =:w zFH1 8~cÓMS}jE\wCHae{ml|#ГO`ק$JۣOݡuh2>]OCJ iESglDn#<\s9ڽԜǠ ,x\$z&oBK\FzV'5a#g@=(&'~ 9㠤\u $)Gg5}9玴 'p3Z4|o33D䏗= hvޣB $t) I1g?P6i'59i6duR* nh:XRGdkTZ֮>RX3ExEլ7Aa?hK?󩅸fҥI89Nv@Y8[m<;Q0Ϸ1/As@ `8VE@x$砨8JH9;s4}Q@=vOO w/M$A=]g8 ?߉_O/!wm68mq(q@;׉s'&4s(9##pFM}G⎓Ql^PU)$x=2F~=KixĖ>I]xb?I1I<~$-m^=˶ 1L9Vցд{='brǿRIׄj5{^;nȗͷ#g珛HeEK-W˱^Mʛ9s$Ҵ`zWja=+kNZr7 ;@ޫHs֛xXnR;'dwwŞOiNg|Rqbk 3pݫ5`UNW|A[=GQm慧2<d3'̠<zx4Xm8UXu O?6A;j~G,zS$bj2OԚ9=H` Sϭ14c1@<ӠZ {sNI 8cPˀ2ϵH*$:f88ӭd Ig$LZvAis cI!TS۹N=PNO|˸4`ry(nrI8 k *͋#X T֌\JnI6Lg6Eh.}s^Z~}3Tcj0$rq@ںRzY08c@yc?h { &;s1B\{Pk ,-ˌg ?Zh2x,;@9Zx3Uycʜ2dN99D9JՖ18~Ui#BRMb][,,AKp~OR>{e{Mx0t+CPW^ 7A L־O7FEd VV , z4|hp'$~sSs>L@N~c"P1p{c9ǡĹȨl㎧jxqջy`@f&_:/g;Y[Y 3Pq#9aZc8RjZ@lU ?`j0յ{HpuAV}rXAathݕ)R0ADaLsMwQǽ1R=#KNp09@ 0HcƘ\21ڛ$ 3HsڣW# rA=LILҀ%$Atgs8ݔ#AhvpϭjBFyiAʌ}xjQUҀ j8)c?b$d#{5 R,GLT2 U ኀ*(Xvic$F5+׎P~CUs`g9@f Ιc)6`{op3ǵb Z26€3#BpۃI"=jߗm#4ҧ*ryEN ::u:AvޥCC^hu#XCUu8+ۧN:v> (?f]:={&ylĭyF=|W_n~|qo=76?7'6; Rd?֣GoQ2s: M:4;ycӽ(9ӥ<^G| L uѻGhw|`1Z?΀9CF8Znt)gym3Q$sKPI&Tg<uȥ֭G>8{Po> -&{Q?A|Sْ Z8@aGrr;׏^Gko$Ҳ)vUI+LGC5%w8 PAqnjzƫt\<⑺ 2zk.KRy׵C,j#w{^dj}A%oRl|?b@ϧ#'olOhm,.qdaT^}^֓Ih2Ł,2HRpP}'dKy*plV׋|Y7+(oԜ (Ub Յ} Ul)ө~0XcNx]ZٶAJ҂ENxW84p#Gf8d:P>0!XPiF ~JOBFV|vdS=OhZYHDV2l:v|皈OUϾ]£:ǚؠrsN#Q<ښ|xqISPDqK~ֹhQ?ʆ ˕*s@0+f30w PЌn>Ly T_pRT6Ǜ FFs qԒxͿ#'ͿOPcޔ8:6O5kRW|/>788!R=;W }.iM;f9ҬkE,36>`P+t&oaC#`A&ϊ:jڭAuʹP_)1Uiͭ\'\Nݻ#kgpFDPsiH<S:v\u`Fr @B~v )*&}IZ=p=E0VeRA u@:b:8@BgX#s\e}e3Si}ozcǘ`dٞ8]5-GTk[YyvRvJ#8$s@Qyx<.GAi0B{{PhO֞!]B_n^G\gyr8,qɫΙ?wԎ?Tքe`0A0 :G=?l-؎'9 F|÷s`r1`"-']hL3}zK ?ր9Ƕ~oZyU.GiA\b)n~48qZ/8pEBˁg1U=JKMws NC EϦIwōn}F k8Aicy+LpWw=\,Y$ s⾇->2`\ a,x=w}/WhZm$\[6n fC ր:H/Y@lU ~XWsuHR2Tt5J7$gV#$zҦ ީ9?*xPQEG"m?܃$mUWZ^fsAZ蕠pq<xJ'{&BG3K<p#8>TkԌ$sM$@;zvA'j=sPհ iKj=g#җpPӏjQ}Zb'ލ{ހϽ(%{昣^=qM'rhzP }&zZasO);dg{{!msҘNW ,q: #SG#ސ1${|3+z%_\QEQEQE{ׂ~#Y[ukm,lj$ crxu2M#P 3@$JƚmK6IJ¯!= PK;ℾ,=-6nXŃE՛Nv-(`YxМv^ޝjk1!`_C@K~xCCEZF99/ĭNH-tǮJn2#G-l6g'm|Er \HA}5dj0 OR}J[Zi;۩> QEQEXRPNS@PL*|<zGhrZҷ/<7q@>nsk/P>#?mcC}jQEQEQEQEQEQEQEVS:Xi3m2s#,py5wH;jΚֹ>!`sĐ;)Hw4d49њ88`m`HT9''$aW4 hiwc՘cq5q3M2wPʧ~ ͽƓ*U `z{f`zڣ{ۦ: em>&~x<̭&L7Dʀ3ßqǃ_ O.94 yWD|?MI =kF;N \3ߊøYeO i QVQS#+?F}kD;H-oޅG9 ~YNzR Iɠ+?ENؠ}9ܬSXF˷wwW6Y\oqq U*A#(((Wz1uV) 3r;Jn8<Jtk_ )8֡eϧPwc$1x AJ3J:xZniҝՈTF 9ne#@$S!y?SSG={T<zb(hn<-M*ӷ1ZF\q@nc߸?ONO4t{=K&83$p$P'ր$=y^N0rH#`sրS = &FORsH[qchg9Q#C@qx?9gFghĕriIT` ڐt_>$x\!Vg {cZkhSh Z6piS#IUQI]clOp@.~L焬P\+50n\e^ݺ9o 8{cB-9qsPEt^8wi m)YYCٳ@uah7eH5 4j-ڠxDݷrgQ@Q@Q@U;L/#L3$I€IZ/G[-ŵ= |H .HI[}SZӴۇ@ q1L#3hQSI9q^k~En&W2F۰O8cFӵtG0j6]ĒFp<o(3 cШEtٶ4ٖ?@ri7z&gt[[ybٷz 8hJ1L9>oOx+ڏiD-s8UۖuP8񞾾𶩫:+Hx9b3uh(#'R8?l|)0> B(@߇\\n²x˞sװ X?xq>:qYZLqsЍM?YCեmPQE+ _~? GnvٽFq"@7t sqӽG ^hc>(l$}3P~LSdq-3~3{@g<w1ؚm< G1gz 1:wǽ H ʗ!y,s8 N9 s=)7zD)ր%$5'A!|P@* `AJ9 ~! )~ьcIqLLb>7D3)EQw)7+ kn((|- ~ID@"Askg_?Ny IePAw)X#qEUv8q+SuT7՞[vX"9\ {$u'f(mvXY!B$>0񆈖lZKyzg%zu'Ԯ^[fr'Fá*á_JXЉT|ݽ:ߴ nǽ#Ie*pF %Z6 >kPcE-@FB9q'ORiA[˕/ގKrPvZd`lyxdV֙ jxtz\Fsҁ28*pAjNs௧8Hm*qVyBy=0kc=f9U ]Řy}i{˸v&C-qa]]yp|ּv@}M*01ZrOƚ3x: .YE^ïN vҴaz>[-^lH9TT aX {Vz?}1l_ Bȷv)בISxPoZ((v4}U.f1:C摁n21ӡ@ ~oa>+J\yqq.ʽrT~h 49OILN Tʌ 8=egYgaivFƹ$(x4=.&Vm\R]$ry 9ٞc:UM0[}j3K{M>t*ڪcp?*888?JG׭C8@\p9 c961@Ԉ㷥 SƃFGz`wqTR 7LնZLdPfׁUI=8*ܬ2OM ~R{`N3j6@́@JqE쯵8]q38ۭ4?8@#ִbp¹mqG"쮷cZu/EbNB6~]&;`[{1UсR ~G1 t'❬Mx^SFH/ wcw|+]/w86Շ6waywk34{mu%Xd<+oT} 8R:F{0ݽ&#FnsԮ7#=)Ş?;=Nz҄ۑ\wjmsMۃg0x b;~4aTA{JEf1IyⲼS:&A#*>@ְ^3=E**? S@Q@Q@Q@fUu-/4{ !C WQzg%##|e <:*ӡaxmMoQԭċܒ` 3F}dQEKii=6ss3qC yP9$R-- E(aPWg}m4=B;e$ 9V2:QEQE|Cdivg˖L@F'4g&.Il湷]Ec99Iy3]oMi}>f]KiZ6+q#ǵT5]ꖯmyj7vύu#`d((L<=.Ζc w,c]~A@$7'!z;N((s%ѫ_u=Iu;in"xe!qV5,Bv '[O:ČuR}BO@b@F(`q\҆'rEbփh]eMj k$JD`(X;EznYSCmb(gV8dq$dkFS}y/hΗe9ϯi N1aX:Eד?~!'<SvSޕFpiid';ѩqڥ*r3٦({uUPX?({;vW3t=@e[}yb?[wPWր7ϧa*CqPi rJОVI_VsWbd^)RDOoS\_|UXShrF~^H^z 9L4ufJ R2SHxy{&y-賾^p 8!?v`S3Wa|㞵W$S$HrAzVlN8z?~+ʩP0{@1X` v=s$ *j G}*଀2X– N x|jS뎽3VUF@4Fp6?Jh\gƐۋcץJ'PWcw9@*c#h8v1RIʌ" {M9 M `,1:t4 ]c+dv˷o^kd`:2gW.#c?LPz( ( ( ( (=Cп2[]yW]6nr;s?n?w#/f|]|DznO8`~я$<z|`@;rA`bzuz(((+.?bx%{{K]"(j#==F =UKp W9l9 Q>ޮ ~>khJWۜsڭ 22V@; {qtyhd:$5s"J7BO#NXp a@EE{ZPs^b 9 =id=xFsz}*&3I tH[}O8$c[9!'- fϵL1P3DwrE#IӮ}a&<ƌNW`r: 'ޔ\z =G49n^x##* Č> =MN#qޙxJpjC'9,Hq c|_CV3Ka@mx] uFsWQEW+4qhV%rFwzv5L]|ȜqF#ҹ_ZV)7|-˟ފއ;q=(_H/6H9V=TcAdsL.O=C{{c>?<k<ʻd28 (iF:'-$eS?Uƣ{;cMgiVN\:+QwPn49ErrOmxÎw>?A*Ġ}2.p bfIb#n{zFH=sJu!cԞiRuQS N@a@ҵ410~ qTm) >E_+r%cpT1P@9^d{zTOnhޟr֗ ʟv6ѣF\B`w8[ԍFo)oO3ySĿ7#qK`:\DyHK2I'ZG#Q#TrI'u2_/G-o݁:|8xjY|ŵxCnKhXS(|DϢhb-[Ʒv6ӥ:ʤE<v߳hKKxGe\Bl??h_Aa{AMl">1/WzoۿV%zv$@\8n8:s@D3r%\A~uf>@E?O#8{+In# F 7Lr}Na_0w6O}2[ q@o==qXp{Rہa400|j|x&#MK=nI=3߷ ?ͻ֍€%~gMD=8(g&摤j[9/38:ӷ\d .ϯ2hr'O_JBxs q9*^:t |*(l֕n@yWX:iSKOjP ;HOМsP~Ӈ>8T-}3M| aQkj((+վŵxΟJ%K^#R9MyM:9HْD!:h߮PmOyti5(ɷo  hz<=iGe.WJ+rG#}sw4{9b򮤋7 yRy|\uܠ:t5ˀx98W ?Jȹbh׉žBP= YZC` Q־(i}M"|Iu)$"4U6A($׈|S*ȱ.ncVIA_={}]\o Aɽ]deȽw +O8p: ( ( ( ( ( ( .p<\JIsQ*FpS_3~~]#Sw0]6D7ʎ"!'r5Q@|kjr2$0gu,69$+1pzW֏ONA+t;$l$.'NNr=NyCq9 +Bz^K&*ȸ' zuy|X"&ao \Z\|{1@> '9K|@}VѮLjwҰh(tq*"v!UTdz(WQ>/U$d?c  s]UF{VW၀GPֵ^2|[½jM3)('׏]H4cz~whX9Ёvᦝ_nO'oQf8p 3@ x_lֵ00r*!~δ>|`{4ڍ䐣jq%N0Nj;qp:+ pF@2H#o\jnn{cՄx (~nI 3=;S2(=@<~8Tj\kR㏵?|@} ϧ+kEcNP @Ŵr֮9zXPn~r$[1ۮztuQ$ #t[HcFs՘\*6i7z ^t @$zI#GP]>:''/-akA%̫#8#ǵ} #?Q'?_'qȱTS`xg?1?H~ xd~USx3YNx5&s!?@d-ψ{ESWAZO^tSi*(4E}>$It_U)1i8pGJ-n٧@='[6 xG=_ťM"Wb0-wD$zI/T?Q}5r 'OhH|#?ƀ>|2E_U '-'|<#itO>@x4#='`d*=#ؿxOUaktO-T˧DO`xc$ZOEP~ d:G_"'ӿ"' 9$ZO?n dE}D?"' J8yؿQwE7UG!^Ogb@>~jVڮ^ ‘+ sHOl< ??U"#GPOǷVTx_1@+'JɈ|yGLEiZoRT-%TT̠G#"2:pA5S|66xɬ*(YY#0q?*(|'O&g6r/l8Vo09\ }6HU?p>OK*%kv@2J^A(1?bO;]x2v9%d]>sװQEQEQEQEQEQEQE|^ᧈtHI.n-K[%ptPs u}[Eu %;k{!p$rܒy=O!@{!/[sIp~c׷WsWM߈Y a!zG8B]X2SĴcbvP8|%wIew ss<Ÿd״د"6 8DYufVE< |3m()G)P)m(2`MjABfE#dZ(<%**񆑌}9PV]wS+bs玾تyXVyUQIFmj,uOۤ ր9*hڼʽ_\ぞGk4Vy2Nr O9>Ey΀2 e9/cO {zzFXSp:~$S)4=*dF/#94,Q&G Ul `m<.s@q(,󎽳Zzlj%<8n]叧Ҟ;fqbG@¶c#50d1Z)i3!U,v6{zVmc> \#|@}E-=k_. KDOchc\3럧J1uҭGI{:V#]=j ӜV\g MO=i*ҬH_˻+ >_ F|Eq?[CJ6C<J$ps¬)s֢d#+4j =q^er$qLtRe W\;}h$c8y854RU8=iZn=8 ;Jt|q=>>Wz])w|@@ c憏ө~2Ău4GTOcGjSqt'zAǷj]OH#0}ɠDXiBwu)9* h[?=PSR*ۡI G@6zT蠰8?SMU=~~:(Ҧ< Qx?jpZQ?xg^+ ?gA5;zv#zդOOpQO/'ƶKĽDWx?O-yU%0[C%#($f/? IuI p9T;$3^Y%rY'7'8 ݉d6{{mNWK^ P z;Guw0S#,+״6IKku3w$+MN -JxZ]`~cp8f#U,;vc Ӯ⼶amNNʜE\~2V$j58ڦ 2IҀ$#})WЌw=)r3ߞ4i\u9(9ȩW`^c< VW|A<3\Ÿ!u nbpq?h/6fct{=)|1`d` dvRN ^aR\\Kwq,O+I;I.2$sm!!C;J^7xx^7Tp 2`6@QU䂾a㺌[Ekg;t~ fF=_i62 E ʱH@,ۇj6! }&T)S*p;((![:Eu~f8݆QbTSZ9xdhG{Vo-E=JYXjGxcjxЃǏnXAg^GJ7_/M r`GQpx }(ϞI?),y9189)L?Nq@<ͤ~җAPR;{ӷ`#=;P\F~sP3A?;vq\T1AUC jE9㎞e[O<8UՀn0}E#8@<GZq}5\7|`8QZz#{U}:{ӷdt;hʸsb?#@R+?zPl29*ͽ|[>E$9NqҀ:+ڪ5gP6"Q~loUY\O)\w21dOnԓz I BɑCus}5"S>o.vYvhIhxGQ:0v?PGzc*#>Nu]h)R5 gKj:t/~^V#<(PcV?F^O^IĿH-}e:${8,ݲ U|E}d| ~>&H.m!-V8(U38x`@@8P^:\Rx'֘nN843sS 889ZyS d1ӎ2r>Ԅ,11@n.H4|9xDϯ;,NhE'pƚOXԓ֣ `g4w<E.̎: #㎽( 0e/ǚ F_]xf<H?xþ+ ▷X"/my YWr[%I*~^8kJ1]^Fdsz ؀@ƙ"Z4b! B`[&GAƲ)c wuEtUfFUoH?Jm~MxYwH >zU &?j{Tٳtm>pÁN1Z T j u6RH%듙2y(k뿌7ýf0`]FҏW(&D(߆/OCוi/mU",T78Yө]-|xZ #ɣ]P ۘ(#|Řx`J((((((+lo 3s]*&"$vR88s1=|g ?Yf,XVDwdfSG '1 0]Oϧ/?T,pAN_ t4"s?'"?G׮CzR|s+^Nn2;S ]H8H09`'OHϴ_z3kHpR N޸ }?@0\}y}r;FN1-[^r+Am'PlsS 2?_܃>*g8׌@*y>;_,_ 5)|Yﲶ4> vYİP͎c$I&4ڐx y9lAn_€ lܜӇI9p;PT\ǯWw>?4aKOJxfL O9 zc58? Xgc(?D\cõJĞS,T) '˩~,88x P68Pq֤f,PrSsF?Z@A~߃S7Zlմ)aT(_;:⍼ |P(.,X)`= k?6u,nQ~Q>' '%>G&I./GpARQ@U9 *FEz$:UݸXD rAߎ:Yb dZʋ$ eO Ug4rI|Ⴁ˒Gy a[xk։+,piJŎv@Gғ a].N{޾#nM0$0c9\!GZ*P" W$xxkF?x@<+~ϷZCx&ӬV^4BN9ݜ83+ dCMnm턚cYo\ A9$3$񬑰tnC)הEm;OK[;uQ$O$O&Vm:`QEc' sETӵ8u(F>>hQEQEQEQEQUV4!ցK#iʑ] 8"1mR\o5+|ɞyv#f8ObJrI? 켗m_p켖m"q 8 T`v /R]Zes-Ooq U*A]|:uYt $d?wPZ|4 tљXW*rONm"'T_$?%]LKj'ކCHtVïz`}mqxA.VGK0 2 d>=FXԮ$yh]ij O+QE[H%[XScʀ*QEQEQEQE"He J5OO^kǬ9`g~=+-CDXaF=Eh)@=}:TX 9G\jw0{dӇRXy4eI3{ U n|=j~nxPǨ&f鑁mHjaڥ p0q>ڥF$ ljz1(E9DlsʤF$9ZV23k~<]#Jcɝ޹}ڽ-NNxZe}b3 ;s{ހ>k!:1,k_4^ot@)S~!a!s֝@PK5?QXNe h$rAG#Yp?'j$9'h/ȑ{9lUy׊k? F_I<*i `Ȧ|~u#= {G+|@}x<𬹗9 w1X1ǁ@ 95vq:{@WA(byX㧩D=¼N*q0? <:ϭ19}i#@'0 rIR=)v3ӎ&=j.Cccb2qPcx"h M;@ퟥ4vNEl/|}pAeB:WQ _J9:b$,so~D2X͎izOF=@ y=F2I$wO X=}q@ 9# Qq6x xºΕnȗS[3(-N>~'~rPEPEPZ^\kᔲ.q x<IَSb0?J`S`1ڮ¸^Z1Gz5M@iZU4, ܊kSIvwE,d#gp Cd1ھ'T͹ݻށ =p:v]:HfA>;(DVʐVcВh㲌gp`85|} M=|.c|  .zܫrzYe@:P|8/1aT5ZI4P8mوAyr6qͭEXI{PI:TnSf,=jdҀ4E&"ou?rxf?}IzsTMV J醣h'=1 Sc%@e9@Q@#:bGrqP^_GdsBXC^.]꥾XIQG'?Qߞze 00sR7 @xݰ3F_DaO> h-̥SJU JC;VQ AFNÚ]]#&)#t7={i> 9?J|d$h|l F]8fb;].;h"#PƊU@Pڷm:bDFqZP'j//ObwWծ HBF,1RO hO=ߴoW]>7De$&@D"`3'[r Gg9qܟ1p2| b5Q$V;ZQG'9>-oImvcqZˏI ƀ<;Z_F,*1|{u=9Vmz7t  ,ȄO;z^s@Vލ]ݰ|F28v J+.~Z'㻸Z[4şiGe]Fp{QEWxf:<9hgt1^]wbx% #OO(I>QS$ 8Lw &:d'c}:㚙\i_8?<~Uv r:5&O}(da/npO&~p; p'ڀ,u xjE$/Sz$g֞p>`?֫eҥWϹαa^yo٧x|cv#8WVO4HŤ_+~2X_1y9 k,O#_z:(I֕^b8'֝cL4nF21?V =kݳ뎕Z +J1*ˀfhّwxqHxWx?c 3Rm"S(ζ8HcI5Rm<{c^?[S_QPs(#ڰn']Ek_o€9ixw5 nZ4E<3W>@ x$r8rAEpaҞ#]8&zp:<(cǭ<'sF۴AHlc'=l:L=G@c14ݒs%m;ܸ ?.%|<.ehة*R+.Gb;E}$ sRkkV}WGln<͗28pk LP;ƘP :Zys gG5 Nc #I,1ހ"vrEFr1 w1r}zPX9GcP6}s}0ԒxT:3߯jbb;r??žh#n$EOnsWެ3L_ g)xv]Ҁ8( *[{Y.8'rx pHI"[h *QNpv<@Nz뎼z;So c9]Ҭq mΟ<:bnG_ԿgX3x~o}ű ˽J<7ݷI[E~>0>*eN8|{ O4c$m/m@=T(2@+~~>3RwUVy ӄq@^p:STŒyYsd(irz걧Zbz׵c|T> Տ|=j+oy6+%czi^gյyhT^^g9hpI G/3_koiMm9d y#?&@c4x34s9 LN.O%zw'0X/#e?Aֲ'3ހksYwn<5(RHmPxrLp_:~p_JqGL:d9 c:8 g4`+n6+tǹvg8c KZqS\r:kCKPvThq?{¤etWa4(T`^6C_@gzc4zRx(6=##=Js#Ӷr)ރp~y3m'ҁ.6Lz }O׈͍eH m#I}X{+ߎc/$WX1I76V;>5kUGʤ砧[Z~gʧE)P@im)P:SSqܵdNĚ(a?DUss\jpzb.8#ހ:u E\GJ[S%rA0kIfȩwҀ9{:[c' ].Ad"Dt> A{+'Eʧ 2dac2ke(X`pA)(_V-PU2G@N323״`rdv\E<36*G ޾aF[j! BKH l۸Lgd僁XgRw3[ѴޫINg# zbsc3&e[cP#MiA 95r)Ju8?5a.z@P{juw#'#L/q (H@ǿA s7=F;C|N24%TBCr=+:kǗ)R\!y8QPX%nr8SAmHϥ7Vl|7\ZZY[&fsnNH : { /:ޯKR2?xW^3?hG_R Һ+83X18={c#tztzgP_[G^xຉN *L`c5eP?*k+-x.!q$r]rkgg{s@ 㠥3`{P8Ml09zPAF8ihOR1ӵ? F#<ៀAS{R\ p9ޙFs޸ @pG@m|ݙ~jL̒Ax碎=+OԖ0pWWkEm*#(~vԼLMbo.dd*8yNc.PӮ7G*0A  +j|XuIyʄJ&Q7A' t$ T{0FO\0r>)lRZD$ӥ%)8YE9 ך5$Wk@mWO92B{|elUcWV:q* (?줶NK<dq{8ߎb= !ƿP*¦A 54qQzP 횚8FTԷCco4H^Ie`$<S_:VHyuTU}`FbBSo8#@#[}VWOu.nd9ڜ$wd6|ARYBE 9bd [^ys$ř؜$I<棠(fTt\A|QXsޮ>jO5 60#IV2!R=}8'YwIW痯OJ͸=>v+&p׸8'<{zX\Lo\(?ΰ.y@=Uַݧ NI+vYG'@ sȪ,">km^pT?(tʌgIdO)0@lThȨ,=밳[Z, d( wR8L:RN3€<;zy㱩6aI#9'?CSG_C`609=9oNSz⤈1ST};{S?^4R8@)8|@'Ox㞄ԩt'\952ڤ33Vc}G^,ub=@9=}je`Fr@9xsqF#׽H f${*5${`cSPߧgh^>R tS9#" g'ӭM3ҡ_ps*uw$GZ߃lռ !pEyOǜDO!װ7@6-hn(v(ߩrzzF1X~#~⢉N;@W#s .}d) @3TOK௴J,_}ךBqh9M?^]rr+C9Ꭷ#ڀ9}L䓊/qߟκHι9ns@8RᇽS *rFqJ<7'Wg ,.zZPc➗`h|4wD9jZm[>A$_hoGBV캥DAٹПm9 ?׃a]Vg#YBFQu8 @ =1Mc\Ï_|1c6&L@<`AAp f0>nOOƒ=M(l )@nNq8?ޚm$N}z>f8҇*1=0 ך^ ϥ Ag w) | gqy<:MwSɤ# k??cLIXCh6}<3y^ȀBE 6<%#\>d5=bΥܽoi:@b_GĻK{gѭNv!, QO,s`yzPrA9I?OP1QEQEQEQEQEf{ytvݠRpfXS:@P n`6Drv1#Q{h嗜?Zo%R}jǢ(Ɵ]MeuvOo! # װ+x;_6`QHp2ܯ8'&Z!}}II/Nw;֒G6~}vQ\ K^ *_.&Wm8'ڰtUA*,{ֵC[#+yd<ܫs d $ 7_K`Y4"4y@8fʂ!p1XPEPEP^5ٱkīf#돳Z$rpsYc#<ի19Y3=h̾}+.P3-OLVdhG54_ִ/~qyAs}hA<,ҹ>\z:.01ހ: Og;ZXc1 eWx#;zpy^wQ;oX r*~ @ :0 OZO1R zwJ1׿Czߍ1xTO= TS/=8CPA۞fW*A*$zP?IqTK'͐;;yhu\{S8q=b O95/}EJ}y51ђ:qATg;mܐa(x0*xp %$ҔP dҩܼ˭e;3??]nP7vMHrF1} Co<c8O^$VFq?ZǸa=9 *\Q' dӜd3KdqS)oDN5*zQ\ԫC1S#q@Wu^QWs~?׊wHN |=%K@j1Pq֢I$`.sP3ӭZ70O85j2>*Ԋc8jeI<|S? /kدJ`i|8N>4ҾqL:=ʾvLrGnd8vu:~_*qzzZ(>|I>ipvNK dVQxGT(yAݦ͋E1STdI;#,㼰5KI3{k)$H8`G@mw7|[u yvhI.s'gtNB/}+':n\Mc pm9k~|f[Gi=V%N̻H'$0rs=\zWxb>C:4wm$s7F(0yrO,1O7ƛ<-{imo}.$1+-6pN1@=73<mBx'Y\jM).'S+?;a  x=rkϼe~ ]I_#l{m8 Z.XĐ'p0j&faen(@,) ˅*1Mr0QhMȣ&|I3FA$ F{ y]ח\J+$F,'I5F[=qSs8QÀ=@~1QRI(((((( ˄>h)(:nx~e@Q@Q@*F A+_Xҡ Qǣt?Q^jl8C᷈D&}@~?*%9E{PKeߞ{W : HcNnl)շ_>m49ǡUʎEt2޵`rФl'\$e=j ( ( Af 1ny>^PǓƱ.0s6zWr$tGw5Q9t ^Jqt#U>ڳm gϒ?II S& XjvWqq *OA9ק: ϭtltY]Oz]>v ^xMat3🎚w<gm.O1̀=0H|`-09eu s׀ךW8]B}1IqU`}+[^:WW`#ހ:+s:׽h@{uV#|΀4-\)"gN: {LCV\~*,=8㿽1?Vt4<; ~(iO~)ix4_>z*+ÍgN%o70䑀$zFŸڧ+ɌRgVY #޻.F9' x@tsrH/3Gnqקf8s3κ wz뇸q܎2vzmqIUa)R8}@0NAzR1Q7;614כ+PLH pp{gH.#K%BE"GR0A c(.~}3ޞ%<375烟.KS#s@`hntJ/dO GFAUn+FS@N،T`8(NRᏑoySH,ʌ3eG!xϘEXALp}8RLSQ@Q@Q@Q@Q@Q@Q@ tvnEk!@9` ʫ zu] ]=q{\QEQEQE*;FYNA᮴xwN/9 >஦xr(p66zN?}kr\p+F/ڹ*r)+~A׭xGS 'GϛK]łt(b9Gu-鶥EVLF#;Xy]ʹwDOE* (:( ( (:/,02[N %O3l^^&b|o/_rn,gh^"O ᗸ3 } =/8<7M;Ŗ]s{QT]11@~"B;ԌcWjj7oQ9'6z֞Ar=M`@zTKg.ǬݸOלk:E!Sz$zcP`w 'vrN[3n:gjgnݩmH@2y9T*1R*s"*>J:S@I9=@ ܜb1$`z{t`x9zgKpH=ULӯJxhs+pU!~^3Ӯ*H= h85#֪[\dڭ0s@W&?zǁ&DŽ[>Y`$bY 2~M8֦F|R? /#kشg▩`i|GzpOzs &@4;NZ9tsZ BU_`K޹xsz`zZҗ;3ׯJ𠞹V$>=;I{_s{_ޯz_FmtPU'T;քpSp: Ƽ^G~Db3WMv5jK>j5-}}/>|@Q@zˣNO#=B 3⻯} gWYlwipk\l yUV}hn`GW5jHM_2cڀ,fs.yvmO*z_G45[}zm)A4$I'=9۾(G]칣5˛m7wqt(T#RG\Zt vvml(뜞I'$$ɫ2ۂH!Js$s:Ҁ&PO<&+t5-ؑNuXGG#M33v?\Mk'{#M9yr*tsPɷ#$iCd6i>N .ŷ+hlR;,?qFvVpq.m x'IUA~:Hc'4T *I2__|qҼ/L_ iV{VdH/P, JA@,QEQEQEbiHnw`3һ 4ivvAn3V?l#GT|A lB^Ewfa[~99^V3kX :9 9u5@H# p)WMˌnz/n俻S$bǮaҡ 0wf6xO%gNр:2xnן70xw ?VC5N>RB(O mFѱÌeQEQEQEQEQEn2l}zsҺ3Ƕ"W:ּx'%7Inlۂ?j xsi:dwk<%ף6 ؗq q"ϷQǰZ q҂ѫ_j=9U_qLv L'TzzNy#&r9zPٟpG%pFOzY:`8OE=Gˑހ+7)d Njڂ:ǽHzs@}1ێ/ز2{vrzc,ANjGO^¾46h|[홆~lُ+?i4v)Eˬfm88ڻH c'^d4 rnJY3Ͼ*IJ w( 1Ud 9t)ިLy>$b M.@=#N5ii${<ͫIei#NXyq1Y&Bq)F~Q@O˥YoRIl0DAw|>gjZt/Y< TPEPEPZp'8'Vus0W8Ut2-28ccҀ?c=)v`= .x5Ozo|q7n7v0A ۽1~ Lhe;M#|w' s=Op*̃8ҡ{ CHY@A[3Gp;@-)Ui+x_l)OzhsƔiVX灜s@ -hƴlo٣nrw$Uiq:zP`Gcn~/TlVCs#e] nF֥;r3Һ"ɸPU{L:6yfCBq<8@Q@Kiw5w]{TTP[__;:spx\7<׋zƏx6϶EчpGq^ŢjL7Аlaqbds N?##$'s@4 LG1}QG$X(J`r9wF|t"}nGj)@99T0N;=\n^T(HSžrWFp?)1BVhoj>5eUYnZ |ŒףrLh$>?"zmB{'FGIrkּ>hL>㟓prF~lzBПY^q@p=zkGn+?W": Ï[\OiyzJػJ`i|q9ץ|a Q:^ ?9׭<~qHOgkr'}&{޾eaP&3\7s Dy8j89W4A_LpEwoAjYf R+~6?;FDVxz2ry A-߽dަW%A'ҷ#Yp87s5H+dds׃{Ӌieᓘghvc;so/;MqߜוRj3;s,nqz( l%'8 nbpOM}{yp@.Iڠ` z־jW[9͊7/cn8t;] zEBo+z>3Y6('oN-Dq/'5 C:03@׏\´{ubU=*ᗨjN*/38=GƓ ?\K#xg1m#ņ㑶F@I /0_ўw[/ N `,qAy =(.@' wªB  0NfO&᳴y#PJB(,I *X7gdķ[OɶX__(m6Ɵu0ːya7^A[Jh}n=n9݆݁ g TQE%0[C%#$p#? j~5{9,obH:Q~.OL_Q vF ^ǚ5υ7Q5KvK}Bprv9pʹだ(((+α~%O!;*v -_\ sG؟G#[d9S9 I0 +cVB|)<nWO@ m\w#0jDW#S792:tM7{v#qh8S)sNqjT hǖHTloZ};To9$w 2j a@#銷*{,7dc 0#ڡfq U@rzsPP#cW-O*LT}{w}({M? zh Z Lj4e:_NkvSa)~W|FқS bNg>X+((=_6xq̢=x/mb'Uܮ?V3p9{(@H|#dc@Ǧ=l1,.'eu9x=GvZTsv*9?Lq֤> ހ6!JA@H$1אN*=9A`1מ4~_zFN;rh8\ ex?ZoIm}.c1Ekz "όwQ[x %ps$QĠd3o:|ǟJڽoDfaԏ{Zc;n8= JA=7r}yNd dfD) ~?z˒;Ht߼z6R[#8?w $H#9S`IR=' ⎧'wq#R)vך@R2}{gȠ2k^[PKLvsGַu$`~~2;P%C^ dYXdjΜv'EOƽ^?WxvBH_r2H1N8G #vk^) D?`VCH3xY6?FyHlqǽ<y8#ۊ!_EI}54,7Ou-69ϝ獽9QLX91ҾR{ދ[f*\ RIv#ր3w,EKp1=+CAλy%m_8tXc+f.W̒K+wbrX$QEPEPEPRW3$g8S^i1sݏXvwvj?v>IC꼮}=UٌwLٴqסX#AW`'1Ե;I Gր2䈁şB2k^Hqj$P4`Pe%Tzs]uu6#47 8cjg-Mec4&e||Q9T@0sW~7ҿ4&UlgSE9yez~qXg0'++-Y Eio眜 q4ʹJI[Kgv 2GsǙnMta `bZޑ94.]p z/KCڸ:<08]Ί6=1d Q$g%2kBFx/JmIKq&l[$HOңf89ϭ|u1~et_;]K 7nc=s #5u 9'kI9c@Ϝm=Y t޾1tVSw΄8=+ؼ.{pH^-0 8^#4ڗ#ϭB3@Qk?z iL6a;n  tMc4mfڥ\ohDAA? iX5 |ZcRB. g$oPnhOc'ZH.O޴m)dYA$rDԀC#j)S0\s@^X̠YHO9$6 N~LUZg$tҀy]ݱ|V n;3ek%ĦI%($kߴ+<>g,Dq p !9t_h{coqJY SF NF1r|EQEQEQETonF>eHW F Sw 5b@_hysבL}~CYP!~uh x7i"FY j>$ YFr] hOU|^t!k](\ 9'8g#^ȱFHݾ{,B@1D0*P<@.a^j$ORڤ K[VvV`rJpN;.xlGc} 27fS،CH(jׂq4>j>kme dCv0r:AS 1H8Գ3I=,⺅X]J:HFSK ?5妙\Obp]Mv[$N0 Z OVeP -@-Ԝ=3nc8_zqsY7v[ȠF I+]|&ٴ0+M;si_6A/#d;=(+?TGN H\ 0 $p*5|A{,yt]zs$kGoEPEPEP]W<25C7RDӎ 9 +LY! fn8~^ip|VVD0NI$I?@xǴ3O'sgԪܧctYh(vJiV| t1yc40qN:cɌ/Q!W`1jV$(LաXzt4;ٜ$qUf?1<0JiN94g}pjxr?kO :n>ڀ9cd_קZr\`t%sڬGc#[ƶ-t05D¯[zosC5=N;UmK{N~O@J!ixrj\ ??w }VE+4o me A-W~6ēA.nE"WS*<GjTs,"k|Ar#G"jHr P!}R<5 _M0="ku,OZu0$#5 `)ץBd~|ث&/k{Ͻ-(ڻv<0s_(CHrr=cWqcm/o Xw4? #r$Ԛ`r?!SDH<2l`_eVA$qӽXH2xؠ}Mu @ݜwHm[e01d(?|1_gx]H}6(gZ6\92 SJSlyj |y'8'ZHi^tAnJ\$s/Wn$>rxg8 2}bFs}jk@ 4hR8Mz߁dҞ>i+?m!3i>:~\6}D ?75j9#XٛnPj3f8@clOc@6~>jSכ6{ 'eKTwd3^\kz5lsO^y*[{b_@HZ3*^/֠J^jtYfLj& ?P]e.ۄVϠ\f^ 9wϥn-F uӯNcJih(_92tf-oiTH@}'^e[/3%5.J~V88'hnZ1תa1L̀?@c^Rng%%8ܬrp0=GA^٬h/r?=~q~#bی}`wwO|uA>K\Xo _õzΥP6H Sq{ugqƲ5ڷBtK飁`Kz cy3 -sͅ=~@?zԸ5ᠣqLUyĿ:[oiz>,Ґ

܎Z7~wK1Irp2HR+: ( ( uOj iZpY& P]q  o>"jEؽn\݁=|V#E' 7QT d $ʼn$'@(//MCR,Oۥ^ '''!'qۥO{qs޹cPڬPoXg᰹ɦH]7+`0@ n8t84?@l[ڬXd$H֭瑳K1U ZCj6pǮ8׫x{V~+.囜=h#TTN @^7펟\ZUna8 Z=:Rz ƏuL!9P8qbOl1ۛh xfA$N0ϵ ͥ;ȊdmF{0?Ɵ U;9ȵoVeAn< ;t]Nu1YFHp 94uL:VsFq~; `Aխ2\A=y'|WiKyjr 5 MA>lmN =UsOI3޴p?3\恬YJPa~?G;B8=yЩcxOmIڪ2O<_ƕ n'7`0Ӷ|@wgx[dyK+Kr,@ . ʥ֠VRyΦ;P z"g'׷J''hC X`` c{cVq#Vl VH>5FG_B_jxFG^ ys*I+GBsz9.2:UOqJ93 թMfܾ2x(6z ֲO'Rg4fidg[mA+eql3Nw=HnS.!'޳ր,Is8PQU]{zfoOҀ-ycuTJps<E|Iph؛qڗǮ;1'QP$ u:]YBl47! ϨkoO6Q{\bܰ?W6@QGuvbUNk<)t]{@Pw5G1O$5 ]\~UUeK`s >!zefei%q٫ƨ(>fea^NH=; <.1qר ^2VӌvSaq$d*eہ+GB1ޞ۹9]X}G#*:PcZ85e{Vϡ@)gd d`ְ008No 8 m?Zq1#<ңtz>zq@X 9ϭx?=?d'_7~_O-yUQ@z)t$)4dda y po po؛^<frWꦷ8-H!qTP0i6~ [[KuQrI sڤP=\iUyfa@^銱jkڳҞ _]49yPў Y7zZ 0YSr0H(Qߵ|x,a12!LC8MyIkk5V=#(I' o5j i[y^40XRqc _፴eSEYy ݎOL`>Ȱi75 {6V\,$fFqm͞>|aV#kJAr#(,@8 ;Ggn!l׻UY2U8' *d|=uu573Iqq3$V,$h*(D[ū^ 48A=Gl` AXF?f;=#֧(p15Aϡ 6)dsLS#Lv)LԭB:օC$ {U&L!'I#e̿ 2v>jZ[q1HRyy#vJ#>W^y#zHx{e OX#9WsHSer ~UlF@=1Am#!.@88[ҬElT(5'7(< wgyGwV@=b+ힹ @yA2>, R=()`=ޕY0–G :1Ͼh9#}kĤ1 `ײ<A^$sۥNUd ztL4p=ϵ:ٺtp?J@HR[`gJ`9䎕wYl1בYQ-xF#ހ1n?5I<K1#0ɒs>p;X QQ'KsߒzGZ gT>fr:R x4?8 Icv`:a^Ny/,r:vIap?y5̇>_,G&HϿ^BpH^-Fo\nbG٘x^Rk{ _Î:}6c9l-1\T\`c>íd9\N'9|ONY?u4\|ߴ8 ;WA Mh߿@.Q_SF:zOZuk|- IUfx"!:(>w? |) >K-#J%fh+GZJ+HTF ~g]L'jxQ#4iF@kW4I}|`d5t(&z}7/Rc=n? ߢ0? A]o@V,re?T3]W>``Dffe,X#aԆ&#ny5 O/IBB>G|;VQz4w+A Z> G.#nm$l{{cz@~u{'s+]Oe>iEjQ=q@ ikW{[SVst'EWKkh;uxQܟA@IT^I>^^n1$gþO p`a,k&!eq4åLq1P'T?uz3OV;{P)7qBJ(}:Cw`95k^z}BKi_,zG{O5=Aszy:/4eF:Mx/0ÆF{#"յlF=rj&j1iK=6+ eq f'$V6\\J[ĆI%(,I2s\w3#khOcΙxR%dFq9 v*yW/|D\;ac \##!I;EpW8z`&8|sPx&Eqf}-9U8=x듏Gc@ ƏՐiN)=9(˸ 44]W$c^jݭoc1MX`Z) (/(m\wX9dG=bV< c ޮ$YGJYc8*uNޥX?dy9H8VvاӮxh3qcϸ 54}2h(ʉǂdcO]Kn4lZ[jVI#]"S P(dveON-:U^)pH$l};um\y7CۭQQ i-y'nx;@\\abw$yG\sVҽI)r}`r: JۏCR1 @h'8y>tbrpkm~r:x8ZSF#l=8U9RC@)gM8lg~SM8-Mk|ؚ+Z,g=@ qQf#~F Q n[q!PxI##zxv@AL9[zazmz(ꃌWw)Vعq)r{bkODcutc(uMn\*=zmKW[em'i{G~ (e/ 湍CS|Tz$6sP=ě:WIZu8=*УWIck+Ҁ?x+:ۯvfc>$ |qjuypw_csXT1/; ;GQH8cT~<IJ-ZR6c9s?KhnC9=oEjU`(*x$Xc@QW p`OOf*sLu%22@,cQd󓌎(ESӜpϨ ՃղJ4Std~O@h͕ Ŀ` УMP@O^OryQZCLh+-Ќr;f&x?ϽL{Kp~Q#@*8$֕q9<8b{QօLo:r6sV_1*@ \r*HtҀ#dp0ԉ #<:p<CG"drr>6 ㏥HG\@ uבn=h1 "ٴ R>HA9JFў3Z#8zԁ@8}ƥ[* .@|IR=۾{TqnpG4CsTR]6Ry*AR=skGn ҠՓ6P,<9눸'& m+6 ր9{gzMZD8WCN}e1%?h'OwA۞UTڮHx }jlgW1E1T62@GSzҀ8:PR,ubSqQUxϽ\z`7>:kW<_ѭ@tQEQEQEH J('''Q@Q@Q@£vEo +d'ח|* z8ۓzPR7;vYgj3@1W1{ר9'`}kzp~p{})O<_֑">, ^NMK91 3V4(=+Nx>ЈckK<cupHkuGOZNuSMWg,O/ď(֔j?KW_,x^5.bxU4l؇QTI^eS:/$:`Ez/p 6v7D>i=&B&<*z~AWQ[\w hoT€ ( ( (. [, $dp ýOEs^9Ga4=~s"nJU^4xߋ15M;VzuŚM j˿~Do_GBh +tP~&x^#7@~y+<_zlfͦY\ N28$qVexխo*+ntCL.;Ir2s 4(~pM ۂ#9n'8$Wg]DIɅ?uA6ޯD@ssDۣCcd}pgb7$}ֻCȦ8}*B3M^GR1qւW#St c(#'l. ހ 1#Њgg,Jy29s ks=Sx HsH~!2c\T7Iy4m@Kn)#3T\qހ#T AC/@;֦A}EI8dPE(#ӹO3z֜bs\ g8'P6`ϦipuTxr84C(sSaڌ:<^* @/]8i9Ҫ2Irp{9イbHS9R(Դ9؉nsSi.K1SWRr=:h@' ?>?t\TkwdUVznROL{ @<~2cG\\N*װ@Lds޾?!jf9~ߏcz4cWquםJs1@08E5r(O)Q@on3Oc:nie; RkTŕ%Ic% zzp@zqP#$ P8"w`V6=}?€2Z㓎¢O,G=ֵ7u800zt$Rg8<ŴیsߕR8㏗NA ץJ:468$´"3=8Tdr= ^fvЇ>4z((*揪hzmA":dT|-koH͍[q7!r>WKm 8־\gSlfwn+a߂Nq W71 RE"d`FAv#Ҁ7mܪ=Ez5k! IlM_+m*?5kwiPAGMzfzi0p?O}Q\CNHL#3_]ZIf94&pJq;X`> ܜ5ޣ߭]9?5uaNO8k2P.WEtŒ]Fr/Ŗ Nէ8> PYmJ?B{`XE )B ÂIԯ-46}Few$:~$@|_W7wgˁ2r8n44?\f|hp3$4k}J]x:>brIRjý.M^kh$*9yf>9@pyj6Mmh#0W1IcM4.N@'ǭO$GsdSYu(TGV|t2Kc3WE)DTc֧mcQ4}0#1PGӒxzcv}>S|GNSv9=@rJTNZ={S$B$t@?)Rr=?*${u51C}:O QӭD_?{~Xǻxh qPJ>gHs>c3Ҁ^Jx@qn1WNiW$RFi=P{u0A8J>!erFzwF}?x;h֠"nSpH qJ<)Q*H,8(֜G1Toۭ&9AQ}*'?]l`zTLc@; <w$t@F8N=N;תr?5FqzbA<4plqږ1n12(Z"q_xxW?5TQlξ*#?%sZ0h((((((~uGo-z$#Z[##-zxdPd؆O ^8=@QscfT^w(]' Ool5"O\t?Tm?5& 6K+8-dILΌ[$ه(㵫E<c!J`9+Ǩ^C^|9*|\WQkZlo`șdۜ8]Kg-Uw| C4'?4WѺedjYc|o0{ un <L΀>|eUm %<'2s\Ρö[Ky7vS%M4,1wس3I=I4oN Jl]OK}X dHS?w@=QlTOaIId=mT`zSţ"0m4 -t^OZ܌֭c8f`s=Y($D(U@$֬k~5Btw3Qӷ$+_&-X苆hH E2yP _ZNBoh60daܓg^E_ (K)WNѤnkf'9o-.mh-.a|`pAb9[`:\͙=7ȁ؀J͏£?{ߡ+MgOtw$Џb:yjݽ]J=X Oz꫕݀9[kX!X~Q߹55ZD#`Ԭ=|z'9)D|ahO󎸧lsSlO<(U?{Ҁ =3vёx6@\02F 4Q:O=i-Ӷh9=H\w4r9㊱g qOc@* < R1ǿjERzG9P@N:TN$g¤#>3ڔfT(ӽ QốOA{{ӶӔu̓8 0!K`ۊ&9 '9'͜x8<.zd, q"#w :Tqҝv0HҀ:{Urp3 ❌tP{G=4]zu-Q`TrAWА:QI#Nj(!S6^8EZ#ۑ9ϹAVGF3T2ޫ7 \v[zun$SA'}1V#;rn^nBAxW|Ia;eR J>xW?5(((((((_l:qӂq^?a\ism+{h_?z[2zc*H.3JL5||4 cxTn_ €= <눺LnHS=n}կUGng?TdZɏndn A"F=M*:M7vL ^}sܗcMD>/PmC=*7py\o$z8@*3G#\ׯY |NLuc$pOr?۷_ܾuudӔ|tCvqa€;49㩩Qrk rP^/P} qy6??S~z:!aq9?0_?œ<_Ȼi~?8=>$kھf޹k x!jWRt1n4.H${zU_2~,^KSWAg^ $2?xRM]?jHJ0Ԛ̠((((((((((((((g4xSZq>u z9ь(?A}~U_Y zg/[>{8XaCsO?xqA@yW=h.& )yfe!T~'2FEbKh]"^է[γF<( c_M[Zj:^`*U@ :9$&5 K!jry3`4䐘 tg98PEPEPa-ׁ>&fA3ѿFgJxVgVDǏ s'*֗zEn*x"'sWP|(r%ҵ;]oW̲(l<=|E~x8B3}j(  8U ljo=3ھ KOp$Ԑsʱ!~?Ny`19f84Kƚw_3]_/x؂J~)LGB)Szzƾw ODU*ט>U}qϽ8}1_:)KWHj-ֹQhU%p8u/5HM֏SXȯAuaS< qO{DX>➼u=+Wץ?t]>(.IܶO!1=yVja%hEKgU$s8(ty';x!C$U $<mF"Ie'͍1 yC_jZ{%rc|2$lXN*}_~~t7Qnc}4!Qݒc$e3;q:wMrhudy.O!zoW@>< }Mr!ߩ?y?rYid':59u^QQ'$X ر$dJ((((((((CAQRCACamera>L=BB @?CARQCACamera.003 ?*=CB5@?IPTS@TIPopenbIpoSSÇ3Dt$e^A}OBDATATS1T@?BHAeBPOBADATApT@*Ae?AeAAeAl5BPBHBPB$BPIPTTS@IPpuff.002U`X`BBQl@@pOBDATATU`1UX>PA%>8?HOB 7>$dDATATU1V`U`Y>PA%>8?HOB>$dDATATV`1VUZ >PA%>8?HOB>$dDATATV1W`V`Z=:A+v˼?}VOB?y2DATATW`1WV[`?{Aؼo?{sOB?zZDATATW1X`W`\?{A!{A$f`o?xOB?uRDATApX*c" >8>P>8@{>8@λV?HA%?HAdc?HDATApY*c" >8>P>8@{>8@λV?HA%?HAdc?HDATApZ *c" >8>P>8@{>8@λV?HA%?HAdc?HDATApZ*R?}V=:?}V@?}V@v3˼A+v˼Am˼DATAp[`*B?{s?{?{s@?{s@ɿoAؼoAXoDATAp\*F?{s?{?{s@O?{s@UI{?x@?x@@oA$f`oAb oWO(]@_WOWorld===??ABBK@ApA ?=LTXh^cTXdamage_ a``` DATA_ _`aFREEDATA_`__ aDATA___`b0DATA_` _bp%DATA` ``_bDATA```` #0DATA````cDATA`a `c` DATAa a``C@DATAa`a DATAaimport GameLogic as gDATA acont = g.getCurrentController()DATAb0own = cont.getOwner()DATA(bpsensor = cont.getSensor("inflictDmg")DATA btarget = sensor.getHitObject()oDATA#067DATAcif hasattr(target,"hp"):ownDATA$c` target.hp = target.hp - own.dmgrDATAC@67DATA67TXhcl^TXenemyListd@dh`h`h` DATA4d@/Users/chris/Art_Videogame/python scripts/enemyListDATAddhDD NDATAde dheFDATAe e`di0)FDATAe`ee ipScenDATAeee`iScEDATAef e`DATAf f`ej.DATAf`ff jp.DATAfff`jDATAfg fkDATAg g`fk` DATAg`gg kDATAggg`k!my")DATAgh gl@!DATAh h`g DATAh`h DATAhimport GameLogic as gDATA hcont = g.getCurrentController()DATAi0own = cont.getOwner()FDATAipscene = g.getCurrentScene()DATA iobjList = scene.getObjectList()DATA`67DATA0j#create a list of all enemies within range 100DATA0jp#change this number to best fit your game areaDATAjg.enemyList=[]DATA kfor i in range(0,len(objList)):DATAk` obj = objList[i] DATAk if hasattr(obj,"enemy"):aDATA$k if own.getDistanceTo(obj) <100: DATA$l@ g.enemyList.append((obj.name))"`DATA  DATA TXhlcTXtrackToEnemym mvPvPvP DATA<m /Users/chris/Art_Videogame/python scripts/trackToEnemy.pybDATAmmvFREEDATAmnmvgEEDATAnnPmw ǕDATAnPnnw`-DATAnnnPQDATAnonw#atorDATAooPnx#REEDATAoPooDATAoooPDATAopox`3DATAppPoxDATApPppy?he DATApppPy0heEDATApqpyhEEDATAqqPpz $; 0:DATAsts}DATAttPs} 15DATAtPtt~@(traDATAtttP~DATAtut@ 15DATAuuPtPDATAuPuu~<DATAuuuPP(traDATAuvu DATAvvPuWDATAvPvDATAvimport GameLogic as gEEDATA vcont = g.getCurrentController()DATAw own = cont.getOwner() DATA0w`objList = g.getCurrentScene().getObjectList()EEDATAQ67DATA$wtrack = cont.getActuator("trackTo")DATA$xmotion = cont.getActuator("motion")DATA67DATA67DATA4x`#check to see if there are any enemies within rangeDATAxif len(g.enemyList) > 0:laDATA@y #create a list of the enemies within range and their distancesDATA4y #each list item has 2 parts: (distance, OBname)REEDATAy enemyRanges = [] DATA(z  for i in range(0,len(g.enemyList)):EEDATA$zp enemy = objList[g.enemyList[i]]meDATA$z dist = own.getDistanceTo(enemy)qiDATA({ enemyRanges.append((dist,enemy.name))DATA{` #sort the listDATA@{ #the first object will be the one with the shortest distanceEEDATA| enemyRanges.sort()DATA8|P #get the second item (OBname) of the first list itemEEDATA$| #then strips 'OB' from the stringEDATA(} nearestEnemy = enemyRanges[0][1][2:]EEDATA}P #set the trackTo actuatoraDATA } track.setObject(nearestEnemy)oDATA} #activate the actuatorslaDATA ~@ g.addActiveActuator(track,1)DATA ~ g.addActiveActuator(motion,1) DATA@ DATAPelse:vDATA@~ #if there are no enemies, activate only the motion actuatorREEDATA P g.addActiveActuator(track,0)DATA$ g.addActiveActuator(motion,1) rPkDATAW67DATATXhlTXTextԀԀԀԀ DATAԀԀԁ@DATAԀԀԁPDATA ԁSpace to fire homing misslesvoDATA ԁPLeft/right arrow keys to rotateAC<ԁԂACObActionԂԂDATA<ԂObjectAC<Ԃԃ`ԁACObAction.001ԂԂDATA<ԂS@ObjectAC<ԃ`ԂACObAction.002ԃԃDATA<ԃObjectOB Y OBCamera x Q%3z?;ƽ%?O????24???42;.?4;.=dz@"????<`@%?4??/=U;.?;-2n??DOBdA??=# ?>=??@???OB Y  OBCamera.003 R:__^;L`?^?^?^????^X?^^X:__^;L`??????ݲR݀2 ?3~4R3&~?݀=Td2A"{#Z?DOBdɖ8?=# ?>=??@???OB Y  OBCube.001tDAgA ?] ?] ?] ???] ?] ?] DAgA ??????v15=ۀ Y?v4Ŀu?TX?DOBdɖ8?=# ?>=?Ԅ@Ԅԅ ԅ ԅԆԇPԈ0?@???@yDATA@Ԅ@ԄenemyropԄlDATA@ԄԄ@hpropAԄDATALԅ sensor1`DATA`ԅԆDATAPԅԆcontԆ DATAԇPDATAԆ hp <=0DATAPԆԅcont1U DATAU Ԉ0DATA<ԇPԈ0  actԇDATA@ԇDATA<Ԉ0ԇPact1ԈDATAhԈ=< OB Y  OBCube.002}?.AgA;r?] ?] ?] ???] ?] ?] ?.AgA;r??????v4wu0ωea?v4俓utu?:Xk7?DOBdɖ8?=# ?>=?ԉ0ԉԊԊԊԌ Ԍԍ?@???`yDATA@ԉ0ԉenemyropԉ\DATA@ԉԉ0hpropAԉDATALԊsensor1ԊDATAԊԊԌ DATAPԊԌ contԋpԋ@DATAԋ@ԌDATAԋphp <=0DATAPԌ Ԋcont1ԌDATAԌԍDATA<Ԍԍ  actԍ@DATA@ԍ@DATA<ԍԌact1Ԏ DATAhԎ =< OB Y  OBCube.003ՆPpVAgA|?] ?] ?] ???] ?] ?] pVAgA|??????v4K;3ZK7?v4F翓v@-X1?DOBdɖ8?=# ?>=?Ԏԏ ԏԏԐ@ԑԒPԓ0?@??? yDATA@Ԏԏ enemyropԎDATA@ԏ ԎhpropAԏLDATALԏsensor1ԐDATAԐԐ@ԑDATAPԐ@ԑcontԐԐDATAԐԒPDATAԐhp <=0DATAPԑԐ@cont1Ԓ DATAԒ ԓ0DATA<ԒPԓ0  actԒDATA@ԒDATA<ԓ0ԒPact1ԓDATAhԓ=< OB Y  OBCube.004Տ@M{AhAp?] ?] ?] ???] ?] ?] @M{AhAp??????v!Gn3zu?v4 ~v{g=?Ԕ0Ԕԕԕԕԗ ԗԘ?@???݀yDATA@Ԕ0ԔenemyropԔ\DATA@ԔԔ0hpropAԔDATALԕsensor1ԕDATAԕԕԗ DATAPԕԗ contԖpԖ@DATAԖ@ԗDATAԖphp <=0DATAPԗ ԕcont1ԗDATAԗԘDATA<ԗԘ  actԘ@DATA@Ԙ@DATA<Ԙԗact1ԙ DATAhԙ =< OB Y  OBCube.005՗A*DAhAl?] ?] ?] ???] ?] ?] A*DAhAl??????vs0׌z?u4~/veDnXm?DOBdɖ8?=# ?>=?ԙԚ ԚԚԛ@ԜԝPԞ0?@???̠@yDATA@ԙԚ enemyropԙDATA@Ԛ ԙhpropAԚLDATALԚsensor1ԛDATAԛԛ@ԜDATAPԛ@ԜcontԛԛDATAԛԝPDATAԛhp <=0DATAPԜԛ@cont1ԝ DATAԝ Ԟ0DATA<ԝPԞ0  actԝDATA@ԝDATA<Ԟ0ԝPact1ԞDATAhԞ=< OB Y  OBCube.006ՠA]AhA)?] ?] ?] ???] ?] ?] A]AhA)??????u332vXl?v4`w]:ZBXH?DOBdɖ8?=# ?>=?ԟ0ԟԠԠԠԢ Ԣԣ?@???`yDATA@ԟ0ԟenemyropԟ\DATA@ԟԟ0hpropAԟDATALԠsensor1ԠDATAԠԠԢ DATAPԠԢ contԡpԡ@DATAԡ@ԢDATAԡphp <=0DATAPԢ Ԡcont1ԢDATAԢԣDATA<Ԣԣ  actԣ@DATA@ԣ@DATA<ԣԢact1Ԥ DATAhԤ =< OB Y  OBCube.007թPAWAhAh?] ?] ?] ???] ?] ?] AWAhAh??????v4|2yXg?v4!ڿu9V X3?DOBdɖ8?=# ?>=?Ԥԥ ԥԥԦ@ԧԨPԩ0?@???Ѷ ѻyDATA@Ԥԥ enemyropԤDATA@ԥ ԤhpropAԥLDATALԥsensor1ԦDATAԦԦ@ԧDATAPԦ@ԧcontԦԦDATAԦԨPDATAԦhp <=0DATAPԧԦ@cont1Ԩ DATAԨ ԩ0DATA<ԨPԩ0  actԨDATA@ԨDATA<ԩ0ԨPact1ԩDATAhԩ=< OB Y  OBCube.008ղAqAhAP?] ?] ?] ???] ?] ?] AqAhAP??????v3FTv2yXg?v48~u6X?DOBdɖ8?=# ?>=?Ԫ0Ԫԫԫԫԭ ԭԮ?@???ѪѰyDATA@Ԫ0ԪenemyropԪ\DATA@ԪԪ0hpropAԪDATALԫsensor1ԫDATAԫԫԭ DATAPԫԭ contԬpԬ@DATAԬ@ԭDATAԬphp <=0DATAPԭ ԫcont1ԭDATAԭԮDATA<ԭԮ  actԮ@DATA@Ԯ@DATA<Ԯԭact1ԯ DATAhԯ =< OB Y  OBCube.009ղ@W`B/A$h?] ?] ?] u~ H=Nmx???]=2$<2>5͇V?5u>@W`B/A$h??????a=qH?)ǀm᾿)\[qsK)ƒ?DOBdɖ8?=# ?>=?ԯ԰ ԰԰Ա@ԲԳPԴ0?@???џѥ@yDATA@ԯ԰ enemyropԯDATA@԰ ԯhpropA԰LDATAL԰sensor1ԱDATAԱԱ@ԲDATAPԱ@ԲcontԱԱDATAԱԳPDATAԱhp <=0DATAPԲԱ@cont1Գ DATAԳ Դ0DATA<ԳPԴ0  actԳDATA@ԳDATA<Դ0ԳPact1ԴDATAhԴ=< OB Y  OBCube.010թPDM@B*|AC<?] ?] ?] u~ H=Nmx???]=2$<2>5͇V?5u>DM@B*|AC=?Ե0ԵԶԶԶԸ ԸԹ?@???є`њyDATA@Ե0ԵenemyropԵ\DATA@ԵԵ0hpropAԵDATALԶsensor1ԶDATAԶԶԸ DATAPԶԸ contԷpԷ@DATAԷ@ԸDATAԷphp <=0DATAPԸ Զcont1ԸDATAԸԹDATA<ԸԹ  actԹ@DATA@Թ@DATA<ԹԸact1Ժ DATAhԺ =< OB Y  OBCube.011ՠoB 8A{s?] ?] ?] u~ H=Nmx???]=2$<2>5͇V?5u>oB 8A{s??????a =qD?)рmḿ)\WqsEb%sf?DOBdɖ8?=# ?>=?ԺԻ ԻԻԼ@ԽԾPԿ0?@???щ юyDATA@ԺԻ enemyropԺDATA@Ի ԺhpropAԻLDATALԻsensor1ԼDATAԼԼ@ԽDATAPԼ@ԽcontԼԼDATAԼԾPDATAԼhp <=0DATAPԽԼ@cont1Ծ DATAԾ Կ0DATA<ԾPԿ0  actԾDATA@ԾDATA<Կ0ԾPact1ԿDATAhԿ=< OB Y  OBCube.012՗WB&EA=?] ?] ?] u~ H=Nmx???]=2$<2>5͇V?5u>WB&EA=??????a򺽏l=qE?)̀mἿ)\[qsJ@2SS)|?DOBdɖ8?=# ?>=?0 İ?@???}уyDATA@0enemyrop\DATA@0hpropADATALsensor1DATA DATAP contp@DATA@DATAphp <=0DATAP cont1àDATAàİDATA<İ  act@DATA@@DATA<İact1 DATAh =< OB Y  OBCube.013Տ&rcB$Ae ?] ?] ?] u~ H=Nmx???]=2$<2>5͇V?5u>&rcB$Ae ??????a_=qH?)̀mỿ)\ZqsKA}(jN?DOBdɖ8?=# ?>=?Ű ƐƐ@ȠP0?@???rx@yDATA@Ű enemyropDATA@ ŰhpropALDATALƐsensor1DATA@ȠDATAP@ȠcontDATAPDATAhp <=0DATAPȠ@cont1 DATA 0DATA<P0  actDATA@DATA<0Pact1ʠDATAhʠ=< OB Y  OBCube.014ՆP[BUUAeܖ?] ?] ?] u~ H=Nmx???]=2$<2>5͇V?5u>[BUUAeܖ??????a򌽏b=qH?)ˀm῿)\ZqsHA)m?DOBdɖ8?=# ?>=?0ˠ ϰ?@???g`myDATA@0ˠenemyrop\DATA@ˠ0hpropADATALsensor1̐DATA̐ DATAP contp@DATA@DATAphp <=0DATAP cont1ΠDATAΠϰDATA<ϰ  act@DATA@@DATA<ϰact1 DATAh =< OB Y  OBCube.015}tMB 7nAC?] ?] ?] u~ H=Nmx???]=2$<2>5͇V?5u>tMB 7nAC??????aTE=qH?)ʀmỿ)\ZqsHAe2&ZD?DOBdɖ8?=# ?>=?а ѐѐ@ӠP0?@???\ ayDATA@а enemyropDATA@ аhpropALDATALѐsensor1DATA@ӠDATAP@ӠcontDATAPDATAhp <=0DATAPӠ@cont1 DATA 0DATA<P0  actDATA@DATA<0Pact1ՠDATAhՠ=< OB Y  OBCube.016tKAJ6A ?] ?] ?] u~ H=Nmx???]=2$<2>5͇V?5u>KAJ6A ??????a냽:=qH?)̀mἿ)\YqsIA-$I=?0֠ ڰ?@???PVyDATA@0֠enemyrop\DATA@֠0hpropADATALsensor1אDATAא DATAP contp@DATA@DATAphp <=0DATAP cont1٠DATA٠ڰDATA<ڰ  act@DATA@@DATA<ڰact1 DATAh =< OB Y  OBCube.017g\AA ?] ?] ?] u~ H=Nmx???]=2$<2>5͇V?5u>\AA ??????a\=qG?)̀mἿ)\YqsJAP7&=?DOBdɖ8?=# ?>=?۰ ܐܐ@ޠP0?@???EK@yDATA@۰ enemyropDATA@ ۰hpropALDATALܐsensor1DATA@ޠDATAP@ޠcontDATAPDATAhp <=0DATAPޠ@cont1 DATA 0DATA<P0  actDATA@DATA<0Pact1DATAh=< OB Y  OBCube.018gAS3ABl?] ?] ?] !i>>;ќ???Gc>]bgIg?&YW>;K? ?$lHAS3ABl?????? ?>y75|I<?ZEj^ɿ=?0 ?@???:`@yDATA@0enemyrop\DATA@0hpropADATALsensor1DATA DATAP contp@DATA@DATAphp <=0DATAP cont1DATADATA<  act@DATA@@DATA<act1 DATAh =< OB Y$  OBCube.019tDB<7@5 ?] ?] ?] )>?)d???>?Ui>^33 ?_}?%DB<7@5 ?????? &>y7n|I<?ZEj^ο=? @P0?@???/ 4yDATA@ enemyropDATA@ hpropALDATALsensor1DATA@DATAP@contDATAPDATAhp <=0DATAP@cont1 DATA 0DATA<P0  actDATA@DATA<0Pact1DATAh=< OB$ Y(  OBCube.020}?tAA?] ?] ?] !i>>;ќ???Gc>]bgIg?&YW>;K? ?$lH?tAA?????? >y7€|L<?ZEj^ǿ=?0 ?@???#)yDATA@0enemyrop\DATA@0hpropADATALsensor1DATA DATAP contp@DATA@DATAphp <=0DATAP cont1DATADATA<  act@DATA@@DATA<act1 DATAh =< OB( Y, $ OBCube.021ՆP2AZAP?] ?] ?] !i>>;ќ???Gc>]bgIg?&YW>;K? ?$lH2AZAP?????? B>y7%|J<?ZEj^˿=? @P0?@???@yDATA@ enemyropDATA@ hpropALDATALsensor1DATA@DATAP@contDATAPDATAhp <=0DATAP@cont1 DATA 0DATA<P0  actDATA@DATA<0Pact1DATAh=< OB, Y0 ( OBCube.022Տ@AAB9J?] ?] ?] !i>>;ќ???Gc>]bgIg?&YW>;K? ?$lH@AAB9J?????? )>y7_|L< ?ZEj^ʿ=?0 ?@??? `yDATA@0enemyrop\DATA@0hpropADATALsensor1DATA DATAP contp@DATA@DATAphp <=0DATAP cont1DATADATA<  act@DATA@@DATA<act1 DATAh =< OB0 Y4 , OBCube.023՗AB aTA?] ?] ?] !i>>;ќ???Gc>]bgIg?&YW>;K? ?$lHAB aTA?????? >>y7.|J<?ZEj^Ϳ=? @P0?@??? yDATA@ enemyropDATA@ hpropALDATALsensor1DATA@DATAP@contDATAPDATAhp <=0DATAP@cont1 DATA 0DATA<P0  actDATA@DATA<0Pact1DATAh=< OB4 Y8 0 OBCube.024ՠA;*B JAS?] ?] ?] !i>>;ќ???Gc>]bgIg?&YW>;K? ?$lHA;*B JAS?????? 8>y7D|K< ?ZEj^Ϳ=?0 ?@???yDATA@0enemyrop\DATA@0hpropADATALsensor1DATA DATAP contp@DATA@DATAphp <=0DATAP cont1DATADATA<  act@DATA@@DATA<act1 DATAh =< OB8 Y< 4 OBCube.025թPAhBDAg?] ?] ?] !i>>;ќ???Gc>]bgIg?&YW>;K? ?$lHAhBDAg?????? 8>y7?|N<?ZEj^ʿ=?  @  P 0?@???@yDATA@ enemyropDATA@ hpropALDATALsensor1 DATA  @ DATAP @ cont  DATA  PDATA hp <=0DATAP  @cont1 DATA  0DATA< P 0  act DATA@ DATA< 0 Pact1 DATAh =< OB< Y@ 8 OBCube.026ղAB[A_?] ?] ?] !i>>;ќ???Gc>]bgIg?&YW>;K? ?$lHAB[A_??????<>y76|I<?ZEj^Ϳ=? 0  ?@???yDATA@ 0 enemyrop \DATA@  0hpropA DATALsensor1DATA DATAP contp@DATA@DATAphp <=0DATAP cont1DATADATA<  act@DATA@@DATA<act1 DATAh =< OB@ YD < OBCube.027ղA%BT@r?] ?] ?] *?^8?.l??>-%.>^CUSx]Yfe-5?F>ςA%BT@r?????>fc4f;JH#>^T=̿0> ӞBCM5?DOBdɖ8?=# ?>=? @P0?@???ڀyDATA@ enemyropDATA@ hpropALDATALsensor1DATA@DATAP@contDATAPDATAhp <=0DATAP@cont1 DATA 0DATA<P0  actDATA@DATA<0Pact1DATAh=< OBD YH @ OBCube.028թPA{BћAu?] ?] ?] *?^8?.l??>-%.>^CUSx]Yfe-5?F>ςA{BћAu?????>fc5f;HH#>^T=̿0>4BCG?DOBdɖ8?=# ?>=?0 ?@???ΰyDATA@0enemyrop\DATA@0hpropADATALsensor1DATA DATAP contp@DATA@DATAphp <=0DATAP cont1DATADATA<  act@DATA@@DATA<act1 DATAh =< OBH YL D OBCube.029ՠA AyAU?] ?] ?] *?^8?.l??>-%.>^CUSx]Yfe-5?F>ςA AyAU?????>fc7f;GH%>]S=ҿ0=B C'8#?DOBdɖ8?=# ?>=? @ !P"0?@???н@yDATA@ enemyropDATA@ hpropALDATALsensor1DATA@ DATAP@ contDATA!PDATAhp <=0DATAP @cont1! DATA! "0DATA<!P"0  act!DATA@!DATA<"0!Pact1"DATAh"=< OBL YP H OBCube.030՗AD=BA[?] ?] ?] *?^8?.l??>-%.>^CUSx]Yfe-5?F>ςAD=BA[?????>fc<f;?H$>_R=̿0>VBCC?DOBdɖ8?=# ?>=?#0#$$$& &'?@???бpзyDATA@#0#enemyrop#\DATA@##0hpropA#DATAL$sensor1$DATA$$& DATAP$& cont%p%@DATA%@&DATA%php <=0DATAP& $cont1&DATA&'DATA<&'  act'@DATA@'@DATA<'&act1( DATAh( =< OBP YT L OBCube.031ՏA'Bt@E?] ?] ?] (? ?_=??0>ӜTBŪ6zʾVP?>qCA'Bt@E?????>fc9f;CH$>`S=˿0>2BC0?DOBdɖ8?=# ?>=?() ))*@+,P-0?@???ХЫ@yDATA@() enemyrop(DATA@) (hpropA)LDATAL)sensor1*DATA**@+DATAP*@+cont**DATA*,PDATA*hp <=0DATAP+*@cont1, DATA, -0DATA<,P-0  act,DATA@,DATA<-0,Pact1-DATAh-=< OBT YX P OBCube.032ՆPA=BaBA~?] ?] ?] (? ?_=??0>ӜTBŪ6zʾVP?>qCA=BaBA~?????>fc:f;MH">_R=ɿ0>BC4?DOBdɖ8?=# ?>=?.0.///1 12?@???КПpyDATA@.0.enemyrop.\DATA@..0hpropA.DATAL/sensor1/DATA//1 DATAP/1 cont0p0@DATA0@1DATA0php <=0DATAP1 /cont11DATA12DATA<12  act2@DATA@2@DATA<21act13 DATAh3 =< OBX Y\ T OBCube.033}ALBa_A o&?] ?] ?] (? ?_=??0>ӜTBŪ6zʾVP?>qCALBa_A o&?????>fc7f;IH$>_S=ɿ0>DwBC!4Q?DOBdɖ8?=# ?>=?34 445@67P80?@???ЎД yDATA@34 enemyrop3DATA@4 3hpropA4LDATAL4sensor15DATA55@6DATAP5@6cont55DATA57PDATA5hp <=0DATAP65@cont17 DATA7 80DATA<7P80  act7DATA@7DATA<807Pact18DATAh8=< OB\ Y` X OBCube.034tAPBS $AhC?] ?] ?] (? ?_=??0>ӜTBŪ6zʾVP?>qCAPBS $AhC?????>fc7f;GH#>]R=˿0=?BCI?DOBdɖ8?=# ?>=?909:::< <=?@???ЃpЈyDATA@909enemyrop9\DATA@990hpropA9DATAL:sensor1:DATA::< DATAP:< cont;p;@DATA;@ DATAh> =< OB` Yd \ OBCube.035gA_BQ@?] ?] ?] (? ?_=??0>ӜTBŪ6zʾVP?>qCA_BQ@?????>fc<f;BH#>`S=̿0>Y !BC.?DOBdɖ8?=# ?>=?>? ??@@ABPC0?@???x }yDATA@>? enemyrop>DATA@? >hpropA?LDATAL?sensor1@DATA@@@ADATAP@@Acont@@DATA@BPDATA@hp <=0DATAPA@@cont1B DATAB C0DATA<BPC0  actBDATA@BDATA<C0BPact1CDATAhC=< OBd Yh ` OBEmpty.001x ?Cl0"<;ƽ%?O???>f?2ı!L???D|3$>3?h>?"ag?1?f0"@j:????<`@%?4??D}>K?"܀$>?1Ҁ4h>aeEzUR@ܤe?DOBdɖ8?=# ?>=?D0D0EPEPFF?@???DATALD0sensorDDDATADEPDATAHDDATAPEPcontEDATAEFDATA<F  actFpDATA@Fpxp OBh Yl d OBEmpty.002x 72Ϳd;ƽ%?O????@l U>N??Qx8?x8?w'= ܼY &*2@f????<`@%?4?Qx8? =ܺYˀ>x8w(=ܳ@n±iʪWb?DOBdɖ8?=# ?>=?FFHHHH?@???DATALFsensorGG`DATAG`HDATAHGDATAPHcontHDATAHHDATA<H  actI DATA@I xp OBl Yp h OBEmpty.003x @>J-;ƽ%?O???? @&bN??Q>x8>x8?w'=?ܳY@O-@:????<`@%?4?Q>x8?=ܹYЀx8w'=ܺj zY1?DOBdɖ8?=# ?>=?IIJJK`K`?@???DATALIsensorJ@JDATAJJDATAHJ@DATAPJcontK0DATAK0K`DATA<K`  actKDATA@Kxp OBp Yt l OBmissleպ??????????????32:q?3ط=d@Ů?DOBdɖ8?=# ?>=?L@LM O ORRU?H???yDATA@L@LbulletlayerropLlDATA@LL@dmgropA LDATALM MsensorMDATAMODATALMO M inflictDmgensor1NNPDATANPPQ`DATAlN@enemyDATALO Msensor1ODATAORDATAPOPcont1PPPDATAPPRSDATAPlDATAPPQ`OcontQ0DATAQ0TDATAPQ`RPcont2QDATAQ^DATAPRQ`cont3RDATARUDATA<RS trackToctS0DATA@S0DATA<STRmotionctTDATAhT?DATA<TUS actUDATA@UDATA<UT  act1UDATA@U t OBt Yx p OBpuffT? W -GA>$d>$d>$d2™2??>$dp[p[p[>$d[p[2[>$d? W -GA?????@H鶥F3ր3#04@H4H贰TAQVV?DOBdɖ8?=# ?>=?V`V`WWWX?zZ?uR?zo?y2@???yDATALV`sensorVDATAVWDATAPWcontWDATAWWXDATA<WXpuffctX0DATA4X0 DATA<XW  actYDATA@Y OBx Y| t OBroboTestooYp;ƽ%?O<@@A0????????;ƽ%?O????[??42x[4/?4 *Ā<_pR9@?DOBdɖ8?=# ?>=?Y[\]^_?@???p yDATAYpDATALYZsensorZPZ DATAZ \DATAHZPDATALZ[Ysensor1[p[@DATA[@]@DATAH[pDATAL[Zsensor2\`DATA\`]DATAP\]@cont]DATA]^DATAP]@]\cont1]DATA]_DATAP]]@cont2^pDATA^pcDATA<^_act_DATAh_LDATA<_^act1`DATAh`=LOB| Y x OBPlaneտ@mk-@|2Vv????????@mk-@|2Vv??????13q/02ZHvK?4N]{hkY@[?DOBdɖ8?=# ?>=??@??? `yOB Y| OBEmptyx 0"<,;ƽ%?O???>f 3:???]3?Xaj?h>dʾah?HC &0"@j:????<`@%?4??]ؾXahʀ?>d ?HG3wh>ai@LP7@6?DOBdɖ8?=# ?>=?``aabpbp?@???DATAL`sensoraPa DATAa aDATAHaPDATAPacontb@DATAb@bpDATA<bp  actbDATA@bxp MAcP&e0MAbot??????????????L>8t???Z ????????@?=?==????MAe0&cPMAweapon> >E> ???????????L>8t???Z ????????@?=?==????MEg2oMECube.001Ђmpniko@hPjP l@P 4?u?u?uDATAhPiDATAi8?u?uuII?uuuIuuuu?uuI?u?u?uIII?u~u?uIIuu?uIu?u?uIIDATAjPkDATAk5 ############DATAl@mpUVTexn@Colo@DATAxmp4DATAn<????????????????????????DATA`o@9|||hhh ||||||hhhhhh MEo2tgMECube.002qˀ  P   q@rp sP?*??PDATAqe0cPDATAq@P DATA>P 8N/@6-> _gFdN/?-)=ޤ;gFӡN/BX.cуN/E=$b#=IN/?>=Z6gF=~N/A?>UHgFKN/@>/3?TGgF=8,_N/?=´?gFqGN/=,/?(gFGN/@?U$gF,ο6-> HAν-"=ޣA<ο>/дο=$խο>=ZAGMο?>UqAX5ξ>/?T\AGk3μ=³?ݣAZSν,e?(УASξ?U$pA3u"VI>ξL?HF.fμ?yQ"4ν=z?ymQ4ξ>]?H>fο>x\>avxο>m>!gf ο=*q ]QοIݽ QνzF>"kf $ξ Q>v*[>A*m>*P_>fQ*<:t>&Q*>> >*>0>|AX5*>>(?,S*π!!3^ŞO. t2v^»!I3^a-O.^»t2]vfHɶGfHB>EfH=ջޠ)Ge3 Aɱ皏AE>A=յޠ$e3 E5#ʾK#ʾ€%*m>Q'*>> >y'j*>>(?,yP*1?,N:ؖ˾[>>0>|?̾m>⥚5>> >Z5Q>>,?,Zf{˾1?,O|ʯ>s1~+?`zN>s1?YGf`&>s1>ܟD`ä>s1>>MB.)>s1Bl?#s*˧>mm-?YjNmEr.~*?zNr-?YGh?&r3>ܟM?är5A>.)r/Bl?#&*˦mm-?YmE>s15?> r25?> 0??YmA젤tWT&V? *[ 9P=e033?̢?SW;<)AҾs?!.޿{M$?YmZr]ʧM$هPΗM$t£_M$>I= JH\M$>>ڴeHM$>(?5՛F#M$>?s: )dM$H?eJs4"n!XЄ |TA. !=4MV&>^CO/A>S*1X-??rI&YCWx`?:{?u 4{-?L; U3?Sd3?@=(FUA?7=:q 3\3?p?*]b$o).ё> >?ޫF̼2?EEC<. A?z3 ? !YIڗv9(l>/Tf9$=AB& fu"(9(7 3Z<9)Lpsg91nϽu ?>*x[ u?"(xuvs> 6x>u=iʁx>uBc=xu>/(>9ցx [u>X>̘xu>zb?$iRx1u=?P2x1u/e?Zx>z=>nl?>5>nj?vs/b?Z~?vq=?P2~1?vs>zb?$iR~1?vs>Y>̘~?vp>/+>9~ [?vsBc=~?vt=i~>?vsvs> 3~>?vt?"(~?vs ?>*~[ 9d>hz0?? ?m]h7-~>?l-guÝ9?nn?f/??rJ0 "qo?f/?z3 ? >?ޤ]lF̼?3D?p?*\s$o)?f,?:=q 3\9?==sj7U9ِ?u 4Y?3A?@=hFU?3A?S zqd?>9?Lξ WM >?u 4zK->[1c?Q:|>(??rIY@W>؊e>SL[*1X>>_CBO/>=4LpMV>ʾ|W@L. >ɾnLߥXЄ?MHH?e4s4?MH>?s:B)d?MH>*?5dtF#?MH>>KeH?MH>I= DH\?MHt=]_?MH侷هs5;Η?MH>Zo1ʧ?MH&V? *0Ng?MH?Ym;/$T?f+s?!.!A{?3G?̤?SW_;<)?(V=e0c%3>Ͼ"P9->;T>$&W? *F :?T?YmA`tWTi>J?PηxUf-?7].?\? Q7i>G?oCx/n^0о'^?b[CH?#N.\>n?D4>?.:Yz,>\?6=)<^I>?b[JSKk?[gz*?ǵ)ڑi0?7fn0>J?Pa@{K0?Z?[zX?0>G?oCa@2Aei>s?Ia@2Ae]>[?[I$3ebx?đa@{KeC?1[c#Z=辴?2#]=ɽx?đɞwK=>[? 3I,2=>s?I2A=>G?oD2A=?X?XF=Ľ>J?PΞwK=ɿ?7ꙇt?z?ǵ=ڑi?YKk?eg?X>?`eJS?z>\?6;=<^I>=>?Nw.:Y>d>n?Ds4>dCJ?#Os.>='X?Nwb>j>G?oDH/n^0??]? a+Q4??7k`>jľ>J?PHUfeB ?4C9K= ?˿6K0?g?t"9XU=?g?tXUvzq>(´Xs*j>rg\yZͿlE>mO8bm>YYb>aK;}x>ʤi<i>)a޹Ryȿ/ >&0wj:IF>YJDUЀv?lsd=*?S0yn?6Zп@>?<ɸq@6?/2|aT=?;TT\}뿇.?6mv(ye?שiE0u忾v=?6HB4:Ðu?LD53}G?3ٿ?@ *uϋ?q}{2?k4z֎c$?L(x>H{OfE?3/vKֿVm8?,wilv0?1} #\ybs/G?;|$^]]J?* ~)T?}^*h?B88jJ*?i,8U5vrv:?hX۴b: ?D >: ?tz CiпR?R-SΟڿRX?ySΫ/ ֿ?lI볖GE _?X I띧ܲJ;?@ CiJ y?J[ >Wl?۴bVҪH?D0??owa.30?H8a@:Do{>[%OT>"+KqW>cƟr`$g:>~XDAgo>aY^[ >?O|qWг>qp^%>%9a*/I/>k;,;g>h#VyN>C_waK>O T;KH\q_N>(Etd8B`fF>Um8AuM>8C2SFomD>j]PH+m>T\!c>&+$Ye ;gſ߰>7#Yfyּ=zK;0E;o-ez6Ε C|zn7[A$ sU vPT=ϟ|!>5xp,m?t'VGfD]?v yŷ`ie w?W! G"3g?X`&IQdp^ry<>Iո &j?.E0m,l?쿞-+edv5?}85bR?+QT-\Rc>9lBfUȡ>Q:Ϧ0 s@}|F"0("`̾G2},x=ϾXD|DN>!{bF>^q9$\!4v%y_.=3s:Ipdon8@@~n\r{\r?ksx}ʙ4 e=$=k 0 -J>ћ_,>ֿsUxV'; d=;׿oK/}v羂r=Gr>:׃Q睥^ϭ>DSA'@r@ٯg7!VڀV[HoΘ wv)tҾ/F7Ǚ1me޸Lz\?0feGH=Ef ?,Ͽ j?M?-:߾u!?]]L&?B_?[+/>A9?\!UoO r?ft'.?t$bAS%M~?L\?[??aC2?F-uG?(;^Tuܯ?bPf UCK?g^Ͼf̬nח?Yؿ[`X|??X_пa+-^v?hվv Omd\{?aѶ<2DB_?`Ca#S0$m^?#UϾ8<?#g2 ks%?M=N[͵-dp?%1+˺}ZX?+T6Hzo?+J7/B4r!?!fE?ͽֲW?i v#|RH~/? }FGРi?<~T@ *?b¾}r@l^6l|Qb:",lWh>x*r>BW>#>38őR6>;ΪMCd>~Vl)`*>(K"JaVBPl)?4>;ΪCd?>:=őR?r>BÿTu#?Wh>b*?t>| Qb ",l?fBq ҕFD?.?[<0$h &v?8* <\)0''?^6f@ ?~'? {Р?W?m v@RH?C?ͽ|yֲ?!?~@!f??+J;/6~r?X?+Y65]zo?df?%1-˺?s?M:͵-?<}?#b'ζ k?]?#UҾM?8??`Ca,0$m?{?aѹ< DB_?v?hپvd\?|??X_ҿ^^??YۿU%`X??g^Ӿf3Tnח?ܪ?bPf:UCK??(ϾLTu??aC4?-uG?Mz?P\s[??.z?t&^mS%?o?ft'?9?\%UcdUO ??[+1>LA??]dLX?B_??-:㾾lu? ?,Կ c`M?[?0fjGZ=Ef?)U0r=Ï4?;gǿ= 0h>!=Xۆ̬>H-=i1>mDd u谥;>uF2⽂)0#?`s_-o9j?\~;a\$z2 ?L(JG?;o<ݵYf>!c>)ܾYe >H,m>ݫT\>mD>j#P>uE>8SFo?`fF>[#m8A?\q_K>(E{+$d8B?L>OT;KH?yN>CeC2wa?;g>h]V?/F,>oʼn,?%>%Ɵ*?Wг>tc^?>?R+q?D=go>e[?$d:> ;~X?:I>9ar`?KqV>p'|?Dk{>[Y^%?0?H?J;}?BCi? _?Xܲ? ֿ?lGE>ܿRX?y2/>̿R?R-2?: ?t{Ci?: ?D>?v7?hZH۴b?vrH?*?i.{U5?*e?B8{jJ?)S?}^?^]]J? ~?s/G?=|$?lv0?1~#\yb?KտVm;? *,wi?HxOfB?3/v>֋c"?L*(x>>2?k7z>ϋ}? q}{?3ؿ?@u?52}D??: Ðr?D>忾v=?ɸB4>re?׫E0u>}޿.?6p(>aT=?;Us\?6?/3L|?Z¿@;?<6Hq@?yn?q6?*?Tv0?v?nTd=?:IC>YNUЀ>ǿ/ >& mwj>d>)"Ry>}ᅵx>ʤ–R<>b >bX;?bm>DYY?ZɿlE> 0O8?{3L>yj\y?*j>(Ks?Ⱦ1?,RI|ʯ?>>7?,IZf{?>> >IZ5Q?˾m>I5?>0>|o!??ɾ[>o!?*1?,R:ؖ?*>>;?,yP?*>> >y'j?*m>Q'?K#¾?E5#%?@=ξޠGe3 ?@88E?AɨG?fD=Ⱦޠ%e3 ?fE;;?fEɴ皏?^¶t2v?^´!ܾ3^ĞO.?t2]v?!_3^a-O.?*V$>?*1?,Rz_`?*O?M&s"4?*>;?,z_S?*>0>|\X5?*>> >z_?*<:@>&s?*PQ>f's?*m>z_?*[>\?λ Q>|?μzD>"{} $?μIֽ ܪs?λ=* ]s?μ>m>!x} ?λ>xb>a|x?κ>e?H@}?μ=z?yms4?μ?ys"4?μL?HF1}?uV8>Ԁ?μ?U$s\3?ν,^?(\S?λ=´?\ZS?κ>/?T_\Gk3?λ?>Uw\X5?μ>=Z\GM?λ=Z$խ?μ8.\Pд?μ-"=ޤ\<?ν6-> N\?N/<?U$,?N/<,*?(֘G?N/:=´?ژqG?N/9>/7?TI=8,_?N/UMK?N/;>=ZC=~?N/>=/˝z#=I?N/-(=ޤIӡ?N/=6-> dd>fRu޵z?) F/B78g1m?Θ wv>!JڀV[>n0rXٯg?^{ >D^An8'>>:!ׁA睥>|$r;yr>cI=;ֿoIi/>>ֿsR'; >1?d.BU*>?k\?y\-WbQ?IW>ћ_q{Vn}?>n@8>~~n\>x =3sŷpd>ǝ>^q7ۤ!4v%?> !{b?,$X=վV.D|?/Ӛ`F,2}?0s@{ |F">PܾϦ>QN7>9lBc'ȡ>>?+Q߫-\>?}£b?,?쿞-)Ddv5?j3?.Eh0m?N>Iÿo &?:npSV?3>?X`6IQ?#'?W!G"?D?v yHie >e?t'Tf?|A>5}no>> vPΫϟ?SpPL'>Wh?Ûv?L x2*ӵ>F@[bcp?D:g$VCwm>$8{={?Cf־%3y٭>;F2?0Nmkz!?D:g$VC~U`m?M=e(ÿW}9?09U!WNG|9E>$8>b*XqF>잿VfbȩU/>ܿ*f9?1 u)$_!a "?<`dOuFW5I? s>U>/|zk7>ew2 >s@>-4?jW=*!4?jXQ$ig?jXQ$STih?jX=5O!5?Ň=#!b/4?ŇQ$ ih?ŇQ$u& ih?Ň=2r!b/?Ň>yGDCTw?Ň>y@CT?jX>yInd85v?jX>yC85҇?ŇPA-؛?ŇS-؛҇?jXP8?jXVY=?jXN4% *?jXN͇%>8>yLUIu>8>yEMIY=>8NJoo *>8Nvooz0?<Ӓ*=m+?xe?z0?N _&9?N [?&>?xVn?:?(厾->do:?>(A.->dovqx?=-)vM)?= vM9?>(IIIz0?>(厶II&Y>8>৒^E<>8>Xn^E&Y?jX>f!><?jX>{!>&[?Ň>ު$\<?Ň>U\<?Ň>eFIII&[?Ň>eDII<?jX>eF[iV&Z?jX>eE)iV<?rW|>< $p&[?rW|> $pX?PÛU5Q?PÛRS5X?^ǾÛUD˻Q?^ǾÛPSD˻Q ?^ǿHfIIV?^ǿHfIQ ?QHfIV?QHf??THf??THfI??^ɿHfI??^ɿHfII??^ɾÛOSD˻??^ɾÛTD˻??SÛQS5??SÛV5??rW> $p??rW>< $p??j[>eD)iV??j[>eE[iV??Ň>eCII??Ň>eGIII??Ň>U\??Ň>ݪ$\??j[>{!>??j[>߄f!>?>8>Xn^E?>8>ߧ^E?W?>(叶II??>(III?oP?= vM?6?=-(vM??>(A.->do?W?>(叾->do?6?ؾ( \;oO?>?ؾl|rW???ؾnrW?oP?ؾ( c7oO??ѽx^??x_??8Nvoo?x>8NJoo?O}>8>yEMI?>8>yLUI??j[Ṅ%?x?j[N4%?~'?j[T?k?j[P8?~%?ŇT-؛?k?ŇNA-؛?O|?j[>yD85??j[>yJnd85?O|?Ň>y@CT??Ň>yHDCT??Ň=2r!b/??ŇQ$u& ?b}|?ŇQ$ ?b}y?Ň="!b/??j[=5O!??j[Q$ST?b}z?j[Q$?b}z?j[=*!DATArp DATAP 5#'# ''# '## #'# ''#''#''#''#' ' #' ' ' # # # ###### #!' !!#!#!#!'!' !# !# !#' # # !#!#!"#"#"#####$#$%#%#%&#&#&'#'#'(#(#(# )!)!!)!")!#)!$)!%)!&)!')!()!,'*,# *' +'+-#-'*+#,-#.4#15#./'/4#12'25#/0'04#23'35#.1#/2'03#*5#*3'+1'+5#-.'-4#,4#,0' 6#7%8(9:#$;#6<#7=#8>#9?#;>#$8';=#$7':?#9':<#6'9'?'6'<':#8'>';#='7'@L#@A'AL!FM#FG'GM!AB'BL!GH'HM!BC'CL!HI'IM!CD'DL#IJ'JM#DE#EL#JK#KM#@E#FK#AG#@F#BH#CI#EK#NO!TU'UV'VW'PQ#WX#XY#YZ#Z[#[\#\]#NS#T]'OU#NT#PW'QX#R[#S]'^_'_`'`a'cd'gh#hj#gl#jl!kl#fl#im'mn'op#ep#io'jm#hi#hp#eo'eg#gp#ef'fg#cm!cn#bf'bk#Rn#Rk#Rj#Qb#P^'QY#Yb#Yk#Zk#RZ#Sd'Sn'Nd#Od'RS#S\#R\#ab'Qa#Q`#Q_#Q^#qr'uv'rs'st'tu'aq#Pv#bq#ar#`s#_t#^u#Tw#wx#Ux#xy#Vy#yz#Wz#z{#X{#{|#Y|#|}#Z}#}~#[~#~#\##]#w###~#}#|#{#z#y#x#w###################################'####'#''#'#####'#####'#!#'##''###'!###!'!#'%##!####'''''##'###'########'#'''!q#v'v#q%q#r#s#t#u#f#O#e'o#m#i#V#P#O'###''''####''''#'#''''!!#!!#########%#%!!!!#!!''''#'#''''####''''###%%!!''''d'd''''c''''c'''''!!K!Kd#E!E#D'D#J'JO#I!C!E#KO##########################'#'##'''#'#'#'#'#'#''###########'#!!##''##''# ' #! ! '' '  ' # #  '  '  # ### #''''##  ##############'############# # #!# !#"#!"##'"##$##$#%#$%#%#'#&''&#(#'(')#()' *#)*'!+#*+'",#+,'#-',-'$.#-.'%/#./'&/'/0#.0#-0#,0#+0#*0#)0#(0#&0#'0#27'18#28#19#39!3:#4;#5;#5<'6=#4>#6>!9?#:?#7?'8?#=@#>@#;@#<@'8;#14#25#7<'?@#:A=BAC'BD#CE'DF'EG#FH#GI#HJ#IK'JL'KL'IJ#GH#EF#?A'AB#@B'CD'MN'UV'NO'VW'OP'WX'PQ'XY'QR'YZ'RS'Z['ST'[\'U]#M]#V^#N^#O_#W_#X`#P`#Ya'Qa'Zb#Rb#Sc#[c#Td#\d#]^#^_#_`#`a#ab#bc#cd#LP!KQ!efLO#KR#Se#Ke#Ge#Ce'CT'Ad#DM'B]#3A'3d#3\'6B'6]#6U'Lf#Hf#Df#Nf#9h#gh'1g'4i'ij'>j#gi#3h#\h'6j#Uj'Xk#Yk#Zk#[k#\k#hj'jk#hk#Wk#Vk#Uk###nq!mn#n~#ln#l'lo#mp#m'pq#py'o}'oq#qx#ry!rz#rx'r{#ru'rs'tu'sv#st#tw#u!u!u|'u}#vx'vw#w}'x}'xy'yz'y'z{#z#{|#{#}'|#~'~'~#'#'#'####''#'#'''##'#'######'##''###'#####'##'##'##'##'##'##'##'##'##'#####'###''##'######'#'##'''#'#''####'#'#'#''#'####'''''#'#'!!###'''#'#!##''#'##'###!############''#'#'''#'#'#'#'##'#######'###################'################''''#####''##'''' !! #'#''##''##!!#'###########''#'#'#' #' #' #' '' ##'# ' # # ##### ##  ##  ##  ##  ## ########$A'A' B#C'#C'!=#>'%>'F'"F'%<'!#"<'!#$7' ##7' #"###$#%# 7#!<#+/''/#'.#-.'&0#*0'(1'&1#(+#),'*-#&(#()''+#+,'&)#)*'',#,-'&*#'-#./#01#.Y'.0#0O'1N'/1#/X'23!24!25!26!27!28!29!2:!2<!2;!3<#3F#34#4E#45#5D#56#6C#67#78#8A#89#9@#9:#:?#:;#;>#;<#=>'>?#>P!?@#?O!@A#@N!AB'AM!BC'BL!CD#CK!DE#DJ!EF#EI!=Q!=F'FH!HR#IS#JT#KU#LV#MW#NX#OY#Q[#PZ#HQ'R['HI'GR#RS'IJ'GS#ST'JK'GT#TU'KL'GU#UV'LM'GV#VW'MN'GW#WX'NO#GX#XY#OP'GY#YZ'PQ'GZ#Z['G[#\r#\q#\p#\_#\]#]_'\k#\l#\m#\n#\o#]r']#_k'_#^`#]#]^'^'`'_`'_#ay#a#a#a{#r'j#'k'c#'j#z'c#s'b'b#b|#bt#u|#x{#v|!w{!cd#de#ef#fg#gh#hi#ij#ck#cs#dl#dt#eu#em#fv'fn'gw#go#hp#hx#iy#iq#jz#jr#kl'st'lm'tu'mn'uv'no'vw'op'wx'pq'xy'qr'yz'''#'##}~#{|'{}'|~'}#~###''#'#'###'####'##!##'###!###'################!##!####!!!#!!!#!#######!#!!#!#!#!#!#!#!#!#!#!!!#############################!!!!!!!!!#####!#!#####!!################################### ### ## ##########!!#####!#!#####!!!!!!!!!######## #####################!!!#!#!#!#!#!#!#!#!#!!#!#  ## # ###!# ! !  ! # ! !  ! #  # # #  ! ## ! ################DATAsVTexˀ UVTex @Col DATAHˀ 4             !!""#%&&''() )! )"!)#")$#)%$)&%)'&)(')( ,* +- *+-,4-.51+4./5214/053240,5*34,-5+*-+1..12//23003*,$8>;$;=7:?96<:9?<6?::<>8;>=;7=L@AMGFLABMHGLBCMIHLCDMJILDEMKJE@LMFK@FGAAGHBBHICF@EKNTUOOUVVWPPWXQTNS]vP^uu^_tt_`ss`arjhglRjlkklfbimeoepooihjmihiopegpghpefgflgRnmjncmcnSdQYbQXYYkbYZkRkZRZ[PvOJONdSNOdR\SRSnR[\S\]efqbfraqabqQbaQa`Q`_Q_^PQ^UTwxVUxyWVyzXWz{YX{|ZY|}[Z}~\[~]\T]wxwyxzy{z|{}|~}~wqrqqDvsrtsutvudEKEdKcdcmcIJCICDEEDOJKOKd                    ! "!#"$#%$%'&(')( *) !+*!",+"#-,#$.-$%/.%&/&'0'(0()0)*0*+0+,0,-0-.0./0/&0:39?18?97?82>6=@4>@;;@<514;828;525<77<@?IJLKGHJIEFHG?@BAABDCCDFEM]^N]UV^N^_O^VW_O_`P_WX`P`aQ`XYaQabRaYZbRbcSbZ[cScdTc[\dKLPQLOPKQRGIKeCEGeCeSTACTdB]MD3Ad3d\6]B6U]HfLJDfHFDMNfNOLfKRSe19hg>4ij41gi3h93\h6>j6jUYXkYkZZk[[k\hkj\khWkXVkWUkVUjkghjinloqmnqp~nmln~ol}ympxypq}xqoyxrzyr{zrxvsr|{ruurst}utwvwtsu}|uux}wvyzz{{|~~                     A$B AC BC#>!=F=!>%F"<!%<"!7$ 7 #+/1(,+()-,)*.-*0&10'./&(1'/+&)('+,&*)',-&0*'-.X/.YO01NY.0ON1/X23<2432542652762872982:92;:2<;F34EE45DD56CA89@@9:??:;>P>=QO?>PN@?OMA@NLBAMKCBLJDCKIEDJHFEIQ=FHQHR[SRHITSIJUTJKVUKLWVLMXWMNZYOP[ZPQRG[GRSGSTGTUGUVGVWGWXGXYGYZGZ[`^]_r\]rq\qp\po\k_\_]\lk\ml\nm\n\or]]_k_^`]^`_|btuya{xayza}{ajrjkcczjcsstbbb|~|uv{wx|vw{dckltscdedlmutdefemnvuefgfnowvfghgopxwghihpqyxhijiqrzyij~}~|{}                           DATA <>>R? >VDP>F>??P>>R>F>>N>.??P>>R>N>.>ϩ7>??P>>R>ϩ7>>¼>{0R??P>>R>¼>{0R>+>N??P>>R>+>N> >#$??P>>R> >#$>7> 0??P>>R>7> 0>."> x??P>>R>."> x>>)??P>>)? >VDP>>R??P?r>T?:>?r>P?r>?A>?M??r?P?r=?N=?B>?r>P?r>?B>?<>@?r>@P?r>@?<>@?7>r?r>rP?r>r?7>r?4>r?r>}P?r>}?4>r?4>8?r>GP?r>G?4>8?6>?r>P?:>T?r>?6>P?,>e(?'e>س?$5>?(>P?'e>س?+>GN?>4?$5>P?+>GN?;j>?iT>/N?>4P?;j>>>Hf>]>q?iT>/NP>>Hf>l>Y>>y3>6>]>qP>l>Y>>> >1>>y3>6P>> ?M>w ?~>'>1>P?M>w ?=>?> ?~>'P?=>?&s>v?# >MD?> P?&s>v?,>e(?(>?# >MDP?> ?# >MD?2>?>P?~>'?> ?>? g>RP>1>?~>'? g>R?K>LP?iT>/N>]>q?>? {>P?>4?iT>/N? {>?5>k^P?$5>?>4?5>k^?-R>8 P?>_,?2>? &1>??P?>_,?>?2>??P?>_,? g>R?>??P?>_,?K>L? g>R??P?>_,>>?K>L??P?>_,?>>>??P?>_,? {>?>??P?>_,?5>k^? {>??P?>_,?-R>8 ?5>k^??P?>_,? &1>?-R>8 ??P?N=?r=?t6=;?}=< P?r??M??}? ?tŝ? P?=>?M>w ? ">u`?>tP>ϩ7>>N>.>yy>R>դ3>)P>>Ű>yy>R>F>}??P?i>Qc?Š>C?>t??P>>Ű>F>}>Z8>??P?i>Qc?A>%o?Š>C??P>>Ű>Z8>>Έ>??P?i>Qc?>D'?A>%o??P>>Ű>Έ>>դ3>)??P?i>Qc? ">u`?>D'??P>>Ű>դ3>)>yy>R??P?i>Qc?>t? ">u`??P?tŝ? ?}? ?|U?m?u'?vP?u'?v?|U?m?|`?D?u4?NP?u;mt?|T;n t?|A=?u=P?u=?|A=?}=< ?t6=;P?'>'?'h">?2k>?3ˢ>-P?'>'?3ˢ>-?2>fC?'jo>gP?'>'?3>#~?2k>?'h">P?'>'?'jo>g?2>fC?3>#~P?/&>?'h">?2k>??P?/P/>L?2>fC?'jo>g??P?9 >>?2k>?3>#~?;_>pP?9>Y?;_>p?3>#~?2>fCP?/&>?2k>?'h">??P?9 >>?;_>p?3ˢ>-?2k>P?;_>p?9>Y?2>fC?3ˢ>-P?/P/>L?'jo>g?2>fC??P?;#?e.?.d?`Z?9W?W??P?=?d~??Vz??`t??P?;#?e.?9W?W?F?[??P?=?d~?i?ZO??Vz??P?;#?e.?F?[?IP?i|??P?=?d~?:?hsL?i?ZO??P?;#?e.?IP?i|?>k?s??P?=?d~?31?r?:?hsL??P?;#?e.?>k?s?0e?mc??P?=?d~??l?31?r??P?0e?mc?.d?`Z?;#?e.??P?=?d~??`t??l??P?.d?`Z??`t?0?Q?.vC?QP?.vC?Q?0?Q??CO?.?C7P?.?C7??CO?)?5?.?5P??`t?.d?`Z?0e?mc??lP?9a?I6?00?H?#RP?w?X>?eR>y?WI>?LP?00?H?#R?=D??J?P?J??=D??=7?F?IȀ?P?IȀ??=7?F?;*?z?HE? @P?HE? @?;*?z?9'Z??D?GP>r?<Ů>@? |e>/?I~>?3vP>vI?Rk>r?<Ů>?3v>?GfCP>?GfC>?3v>M?)l> ?<P=A?>Qo/?>Qo?=M=A?=tP>C>>=S>e=A>e=A>P>?>yt?u>>)???P=A?=A>e>=S>e>Qo/?P>@? |e>r?<Ů>R7?=m>v?<P>@? |e>v?<>>)?>yt?uP>?>/?I~>yt?u??P>/?I~>@? |e>yt?u??P>?>M?)l>/?I~??P>M?)l>?3v>/?I~??P>vI?Rk>Q{c?Rx>R7?=m>r?<ŮP>QpW?RQ>&z#?RQ>Qo?=M??P>&z#?RQ>QpW?RQ>Qq?qw>(?L>R?N*> ??L>y?WI>R?N*??P>R?N*>?GfC> ?R?N*>]?O5i>?GfC??P>vI?Rk>?GfC>]?O5i??P>vI?Rk>]?O5i>{?Wg??P?K*?0@?>?#R?J5?%J??P? 00?w^?O?l[vI?Rk>(?f'W>c'?t??P>vI?Rk>c'?t>Q{c?Rx??P>vI?Rk>{?Wg>(?f'W??P>c'?t>(?f'W>\?u??P?+O>5q?;M>?>j>hz?+>P?@h>1?3?8?+>?>j>hzP?D?G?9'Z??@h>1??P?9'Z??3?8?@h>1??P>?L> ?<>?93??P>?L>?93?>????P>?L?>??? '?FC??P>?L? '?FC? .g?NR??P?w?X>?L? .g?NR??P>Ƿ ?m>W?<>?v>*?wVP>h9?vԾ>Ƿ ?m>*?wV>Қ:?pP>?eR>h9?vԾ>Қ:?p>7?fP>y?WI>?eR>7?f>?]|dP>R?N*>y?WI>?]|d>_?W֖P>]?O5i>R?N*>_?W֖> ?WP>{?Wg>]?O5i> ?W>"%?]bP>(?f'W>{?Wg>"%?]b>Y?f}vP>\?u>(?f'W>Y?f}v>?pUP>W?<>\?u>?pU>?vP>*?wV>?v>i?f??P>Қ:?p>*?wV>i?f??P>7?f>Қ:?p>i?f??P>?]|d>7?f>i?f??P>_?W֖>?]|d>i?f??P> ?W>_?W֖>i?f??P>"%?]b> ?W>i?f??P>Y?f}v>"%?]b>i?f??P>?pU>Y?f}v>i?f??P>?v>?pU>i?f??P> y?v>2?f>M?p@??P>M?p@>2?f>?fb??P>?fb>2?f>?]5??P>?]5>2?f>?W ??P>?W >2?f>[`?W??P>[`?W>2?f>?]??P>?]>2?f>?f??P>?f>2?f>J?pS??P>J?pS>2?f>3:?v,??P>3:?v,>2?f> y?v??P>3k? > y?v>M?p@>H?u[P>H?u[>M?p@>?fb> ?f 7P> ?f 7>?fb>?]5>P?WoP>P?Wo>?]5>?W >4?OFP>4?OF>?W >[`?W>˔?NP>˔?N>[`?W>?]>u9?WP>u9?W>?]>?f>?f!P>?f!>?f>J?pS>s?wP>s?w>J?pS>3:?v,>ƍS?P>ƍS?>3:?v,> y?v>3k? P?|?X`? O?NX?> ?M??P> ?M? O?NX?? /?F ??P> ?M? /?F ?*?>p??P> ?M?*?>p>O?9??P> ?M>O?9>?1c?3:???P?D??@>1c?9$???P?@>1c?>P>h8?+>(?3:?P?+>5@?+>(?>P>h8?;;>P>c7?s݆>H?u[> ?f 7??P>v:??RyC> ?f 7>P?Wo??P>v:??RyC>Q+?R>c7?s݆??P>v:??RyC>c7?s݆> ?f 7??P?9 ?I6m?@?Q?B|?=KL??P?9 ?I6m?6?W?@?Q??P??+z?xS2?Ea?m?H?v??P??+z?xS2?>k?s?Ea?m??P?K(:?0?Jƛ?%J?>N?# ??P>v:??RyC>P?Wo>4?OF??P>v:??RyC>4?OF>?Gk??P>˔?N>?Gk>4?OF??P>˔?N>?<>?Gk??P> ?M>˔?N>u9?W??P> ?M>?<>˔?N??P=O$ ?RQ=H*?|< ?qw< -*?RQP< -*?RQ< =*?=7=O$ ?RQ??P>v:??RyC>q?<>Rl3?=>Q+?RP>?)h>?T5>?3}??P>x?I>?T5>?)h??P>?T5>S?r>k? ??P>x?I>S?r>?T5??P>k? >S?r>j?F>?]P>k? >?]>Rl3?=>q?<P=A?< Ej?<ɕ>e=A>eP>x?I>j?F>S?r??P=A>=A>e<ɕ>eP=A?=A?=t< =*?=7< Ej?P>?Gk>?<>?)h>?3}P>v:??RyC>?Gk>?3}>q?<P>q?<>?3}>?T5>k? P?HB? ??D??9$??;t?*P?I?^?HB? ??;t?*?=4?F~P?J?d?I?^?=4?F~?=?P?Jƛ?%J?J?d?=??>N?# P?0.?H:?/N?T?6?W?9 ?I6mP?|?X`> ?M>u9?W>?f!P?K(:?0?>N?# ?/?&0?0C?2P?B|?=KL?K(:?0?0C?2?0]?=sP?9 ?I6m?B|?=KL?0]?=s?0.?H:P?a???k?O?Q?\?Ku ?Q&P?k?O?k@5?`+?Rn?e?Q?\P?k@5?`+?k?}$?R ?y %?Rn?eP?R?9?a???Ku ?Q&?C+?LHP?Ku ?Q&?Q?\?L/V?c;?Aa?SDeP?oa??n?%(?W?%B?ZM?XP?+?B??px?B~?z?-d?.2?-euP?n?%(?r"?'?~?*g?z?-dP?W?%B?_19?'z?o?; ?px?B~P?px?B~?o?; ?vD?/o?z?-dP?n?%(?z?-d?vD?/o?lGL?"iP?n?%(?lGL?"i?_19?'z?W?%BP?m^#?hdA?m^'?] ?r۵?\(?r۵?hP?ma>?y?m^#?hdA?r۵?h?r۹?v)P?m^'?] ?maB?KxU?r۽?N{!?r۵?\(P?r۵?\(?r۽?N{!?yP?N{!?yP?\0P?r۹?v)?r۵?h?yP?h?yP?v)P?yP?h?r۵?h?r۵?\(?yP?\0P?~Ż?] ?yP?\0?yP?N{!?~(?KxeP?~ ?y?yP?v)?yP?h?~Ŷ?hdAP?~Ŷ?hdA?yP?h?yP?\0?~Ż?] P?n3?&?W?%?-iP?p?B?z>?-i?v?/?o?;!^P?W?%?-i?~,?*m?r$#?*P??Bѷ?)?-k?z>?-i?p?BP?ob??ZP?v?W?%.?tt??P??l?0e?mc?)>.?tt?#4i?vnP????l?#4i?vn??P?j?Ha?U?.9?W?%B?px?B~P?Ud?.?jz ?H_Y?p?B?W?%?y?r۹?v)?o'?~;??P?yP?v)?~ ?y?}?~3??P=A?=t=?Rs= ?Rs??P>Qo?=M>&z#?RQ=?Rs=A?=tP< =*?=7=A?=t= ?Rs=O$ ?RQP?)?5?;%?'k*?&?-ޕ??P?.?5?)?5?&?-ޕ??P?.?5?&?-ޕ?.K?'~??P??+z?xS2?0y??0e?mc??P??+z?xS2?0e?mc?>k?s??P? 00?w^?31?r??lP? 00?w^??l??P=>>Vi>>Vi>'=>'P=>'>Vi>'>Vi>L=>LP=<Y>Vi<Y>Vi=1F==1FP==1F>Vi=1F>Vi===P==>Vi=>Vi=a==aP>Vi>`>Vi><*>p><*>p>`P>Vi><*>Vi>7M>p>7M>p><*P>Vi>7M>Vi=a>p=a>p>7MP>Vi=a>Vi=>p=>p=aP>Vi=>Vi=1F>p=1F>p=P>Vi=1F>Vi<Y>p<Y>p=1FP>Vi>L>Vi>'>p>'>p>LP>Vi>'>Vi>>p>>p>'P>Vi>>Vi>a>p>a>p>P>Vi>a>Vi>`>p>`>p>aP>> s>y=+>O>-c??P>w8>)l>> s>O>-c??P>~{>Hߴ>w8>)l>O>-c??P>l->^ >~{>Hߴ>O>-c??P>)>`N>l->^ >O>-c??P>U>P==>)>`N>O>-c??P>&>2>U>P==>O>-c??P>>>&>2>O>-c??P>q=o>>>O>-c??P>y=+>q=o>O>-c??P>~W>a>$>a>Vi>=>P=>a>~W>a=>??P>$>a>Vi>a>Vi>??P>%u>7M>W>7M==a>Vi=aP>Vi>7M>%u>7M>Vi=a??P>W>7M=>7M==a??P>><0>VAV8=X̽>>=;P>U=.>>h=R>>o=f>U=6P> =e8> =>Ǭ=>Ǭ=e8eP>Q><0>>=;>P=;P>>h=R>== >F=e>>o=fP><>>QP=;>=X̥P>== >=->=r>F=eP>x=Q>x=e7o>b'=e7h>b'=NP>P=;>F=e>b'=N>b'=e7hP>>=;>>o=f>F=e>P=;P>Ǭ=e8e>Ǭ=>>o=f>>=;P>Vi><*>.><*>%u>7M>Vi>7MP>Vi>`>.#>`>.><*>Vi><*P>Vi>a>$>a>.#>`>Vi>`P=>a=>`>>`>~W>aP=>`=><*>3><*>>`P=><*=>7M>W>7M>3><*P=>`=>a=>a=>`P=>a=>=>=>aP=>=>'=>'=>P=>'=>L=>L=>'P=<Y==1F==1F=<YP==1F======1FP====a==a==P==a=>7M=>7M==aP=>7M=><*=><*=>7MP=><*=>`=>`=><*P=>`=>a=*>a=*>`P=>a=>=*>=*>aP=>=>'=*>'=*>P=>'=>L=*>L=*>'P=<Y==1F=*=1F=J<YP==1F===*==*=1FP====a=*=a=*=P==a=>7M=*>7M=*=aP=>7M=><*=*><*=*>7MP=><*=>`=*>`=*><*P=*>`=*>a;l>a;l>`P=*>a=*>;l>;l>aP=*>=*>';l>';l>P=*>'=*>L;l>L;l>'P=J<Y=*=1F;l=1F~;m<YP=*=1F=*=;l=;l=1F~P=*==*=a;l=a;l=P=*=a=*>7M;l>7M;l=aP=*>7M=*><*;l><*;l>7MP=*><*=*>`;l>`;l><*P>wY>>{X>=>ի>??P>{X>=>>mC>ի>??P>>mC>>c>ի>??P>>c>.>uw>ի>??P>.>uw>>d>ի>??P>>d> >=>ի>??P> >=>>b>ի>??P>>b>>3>ի>??P>>3>|>>ի>??P>|>>wY>>ի>??P?r:`>\?i?Ď?e|_??k3>^FP?^?'?^>h?k3>^F?e|_?P?h!>vz?k3>^F?^>h?_>P?P?~?L6?_?DX>*?J">BP?W?#?P?~?J">B?W>P?W>?J">B?N>z?V>P?^?'?W?#?W>?^>hP?_>?^>h?W>?V>P?_>?V>?U~Q>Јh?a6Y>ЈjP?a> S?R\> Vl?Rl(=v?a=@P?>8??=3? ,>G?E>P>=>=???=3?>8P>=>=7>=?>=P?a=@?Rl(=v?RvX=_?a@=`sP?a@=`s?RvX=_?Rh=V><>=7>=P?GS<~c?K~=|z?=="?:G;aP?K~=|z?J><?C>;.?=="P?:G;a?=="?.-=?%OW;XP?=="?C>;.?;?.-=P?%OW;X?.-=?#=E?u;?/>C?#=EP?uC?+ >N;u?6:=UP?lV[=G"?Yc >vA?p]r>MGP?V>G"?q?=I>:?Yc >vAP?p]r>MG?Yc >vA?[y>W?pg>aGP?Yc >vA?=I>:??[y>WP?pg>aG?[y>W?__>?l>P?[y>W??;ֺ>W?__>P?E>? ,>G?>t? 7>*mP? E=}? .m=8?=J??P>U>%c?>&?>re>/??P>=?>8>U>%c>=4P>FM=b>=>=>=4P>FM=b>=4>}=3>$=_P?`p>ˋ~?lQ>?l>?__>P?RvX=_?K~=|z?GS<~c?Rˋ~?__>??P?KYx>?;ֺ>W??P?Ojc>P?K~=|z?RvX=_??P?Ojc>P?J><?K~=|z??P>=?? =p? E=}??=3P>+=?>=7P>+<>; =?5U>%c>re>/>}=3>=4P?^?'?e|_??d? ?` ? *P?P?~?W?#?Vf? (?Q_? P?W?#?^?'?^O? :+?W? 6P?i?Ď?d? ?e|_???P?i?Ď?cy??d? ??P?L6?_?P?~?Q_? ??P?L6?_?Q_? ?R?n??P?g?''?;?'?Z+?6-??P?g?''?Z+?6-? ?Z+?6-??5??P?ƿ?<>?5u??1?Z+?6-??P?^O? :+?`?@)?UW?8?W? 6P?2? f?ws?8? :?1??P? ɓ?Wj?2? f? :?1??P??Wm?ws?8?2? f??P>p?(>>ۏ>>4 >?LP>e_?Ǫ>p?(>?L>??`qP>O?>w/>>p?(>e_?ǪP>>ۏ>p?(>w/>>>YP>>4 >>ۏ>9>>+E>oP>oFs?>MC? >e_?Ǫ>??`qP>b\?|> ?>??`q>?LP>2?a>b\?|>?L>>4 P>ڟ:>.>ՉU>i>Î>??P>>ƌ >ڟ:>.>Î>??P>M>~>>ƌ >Î>??P>.?4>m?s>'>y>e?6P>4 >>M>~>Î>>>螅P>L_>A>U>+>'>y>Qf>QP>+E>o>->H>Qf>Q>w>RP>m?s>w>R>Qf>Q>'>yP>->H>+E>o>9>??P>4 >>->H> >??P>->H>9>> >??P>s9?>?v>w>R>m?sP>s>E>G>)X>ڼ>>>ƌ P>p>">s>E>>ƌ >M>~P> >>p>">M>~>4 >P>>}>)&>'o>9>>>6P>y#>>>}>>6>k>t)P>]>A>y#>>k>t)>->tP>>Ȣu>]>A>->t>(>ğP>8>9>>Ȣu>(>ğ> >P>)&>'o>8>9> >>9>P?.? Bv?ۖ? d?2>?a>e`P?#?m?.? Bv?a>e`?" >P?.??#?m?" >?,1>P>?4>D?>y> >>OP?? 7A>?4>>O?{>TP?ۖ? d?? 7A?{>T?2>P?D>?Ҡ?? 7A?ۖ? d?۴? P>tV?k#>?4?? 7A?D>?ҠP>?#>tV?k#?D>?Ҡ?('?1P>؎?>>D?>?4>tV?k#P>ڲK?$>؎?>>tV?k#>?#P?%֫?y?#?m?.??1P?%&^?%3?%֫?y?1?2N9?$P?fF??.? Bv?#?m?%֫?yP?M?#q?fF??%֫?y?%&^?%3P?۴? ?ۖ? d?.? Bv?fF?P?ց?hs?۴? ?fF??M?#qP?2? f?j?#C??Wm??P?2? f??'?j?#C??P?2? f? ?%֫?yP?%֫?y?1?.??#?mP>ڲK?$>?#>tV?k#>؎?>P>؎?>>tV?k#>?4>D?P>?#?('?1?D>?Ҡ>tV?k#P>tV?k#?D>?Ҡ?? 7A>?4P?D>?Ҡ?۴? ?ۖ? d?? 7AP?ۖ? d?2>?{>T?? 7AP?? 7A?{>T>>O>?4P>?4>>O>y> >D?P?.??,1>?" >?#?mP?#?m?" >?a>e`?.? BvP?.? Bv?a>e`?2>?ۖ? dP>)&>'o>9>> >>8>9P>8>9> >>(>ğ>>ȢuP>>Ȣu>(>ğ>->t>]>AP>]>A>->t>k>t)>y#>P>y#>>k>t)>>6>>}P>>}>>6>9>>)&>'oP> >>4 >>M>~>p>"P>p>">M>~>>ƌ >s>EP>s>E>>ƌ >ڼ>>G>)XP>s9?>m?s>w>R>?vP>->H> >>9>??P>4 >> >>->H??P>->H>9>>+E>o??P>m?s>'>y>Qf>Q>w>RP>+E>o>w>R>Qf>Q>->HP>L_>A>Qf>Q>'>y>U>+P>4 >>>螅>Î>>M>~P>.?4>e?6>'>y>m?sP>M>~>Î>>>ƌ ??P>>ƌ >Î>>ڟ:>.??P>ڟ:>.>Î>>ՉU>i??P>2?a>>4 >?L>b\?|P>b\?|>?L>??`q> ?P>oFs?>??`q>e_?Ǫ>MC? P>>4 >+E>o>9>>>ۏP>>ۏ>>Y>w/>>p?(P>O?>e_?Ǫ>p?(>w/>P>e_?Ǫ>??`q>?L>p?(P>p?(>?L>>4 >>ۏP??Wm?2? f?ws?8??P? ɓ?Wj? :?1?2? f??P?2? f? :?1?ws?8??P>|>>ի>>wY>??P>>3>ի>>|>??P>>b>ի>>>3??P> >=>ի>>>b??P>>d>ի>> >=??P>.>uw>ի>>>d??P>>c>ի>>.>uw??P>>mC>ի>>>c??P>{X>=>ի>>>mC??P>wY>>ի>>{X>=??P=*><*;l><*;l>`=*>`P=*>7M;l>7M;l><*=*><*P=*=a;l=a;l>7M=*>7MP=*=;l=;l=a=*=aP=*=1F;l=1F~;l==*=P=J<Y;m<Y;l=1F~=*=1FP=*>';l>';l>L=*>LP=*>;l>;l>'=*>'P=*>a;l>a;l>=*>P=*>`;l>`;l>a=*>aP=><*=*><*=*>`=>`P=>7M=*>7M=*><*=><*P==a=*=a=*>7M=>7MP===*==*=a==aP==1F=*=1F=*===P=<Y=J<Y=*=1F==1FP=>'=*>'=*>L=>LP=>=*>=*>'=>'P=>a=*>a=*>=>P=>`=*>`=*>a=>aP=><*=><*=>`=>`P=>7M=>7M=><*=><*P==a==a=>7M=>7MP======a==aP==1F==1F====P=<Y=<Y==1F==1FP=>'=>'=>L=>LP=>=>=>'=>'P=>a=>a=>=>P=>`=>`=>a=>aP=><*>3><*>W>7M=>7MP=>`>>`>3><*=><*P=>a>~W>a>>`=>`P>Vi>a>Vi>`>.#>`>$>aP>Vi>`>Vi><*>.><*>.#>`P>Vi><*>Vi>7M>%u>7M>.><*P>a=eZ>=;>+=v>b=P>=;>>P=;\>>V=w >+=vP>>P=;\>Ǭ=eX>Ǭ=P>>V=w P> =4>Ǭ=P>Ǭ=eX> =eXP>>==B>>V=w >U=>U~=?P>U< >U=X.>>P=;\>>N = >+=v>>V=w >>==BP>>N>P=;\>=;><P>xX=e[>a=eZ>b=>x=BP>=>>=z>+=v> = P><>=;>|=X>w<>P>W>7M==a=>7M??P>Vi>7M>Vi=a>%u>7M??P>%u>7M>Vi=a==a>W>7MP>$>a>Vi>>Vi>a??P=>a=>>~W>a??P>~W>a=>>Vi>>$>aP>y=+>O>-c>q=o??P>q=o>O>-c>>??P>>>O>-c>&>2??P>&>2>O>-c>U>P==??P>U>P==>O>-c>)>`N??P>)>`N>O>-c>l->^ ??P>l->^ >O>-c>~{>Hߴ??P>~{>Hߴ>O>-c>w8>)l??P>w8>)l>O>-c>> s??P>> s>O>-c>y=+??P>Vi>a>p>a>p>`>Vi>`P>Vi>>p>>p>a>Vi>aP>Vi>'>p>'>p>>Vi>P>Vi>L>p>L>p>'>Vi>'P>Vi=1F>p=1F>p<Y>Vi<YP>Vi=>p=>p=1F>Vi=1FP>Vi=a>p=a>p=>Vi=P>Vi>7M>p>7M>p=a>Vi=aP>Vi><*>p><*>p>7M>Vi>7MP>Vi>`>p>`>p><*>Vi><*P====a>Vi=a>Vi=P==1F==>Vi=>Vi=1FP=<Y==1F>Vi=1F>Vi<YP=>'=>L>Vi>L>Vi>'P=>=>'>Vi>'>Vi>P?/P/>L?2>fC?'jo>g??P?;_>p?3Ұ>0O?2>fC?9>YP?9 >>?2k>?3Ұ>0O?;_>pP?/&>?'h">?2k>??P?9>Y?2>fC?3Lj>O?;_>pP?9 >>?;_>p?3Lj>O?2k>P?/P/>L?'jo>g?2>fC??P?/&>?2k>?'h">??P?'>'?3Lj>O?2>fC?'jo>gP?'>'?'h">?2k>?3Lj>OP?'>'?'jo>g?2>fC?3Ұ>0OP?'>'?3Ұ>0O?2k>?'h">P?u=?t6=;?}=< ?|A=P?u;mt?u=?|A=?|T;n tP?u'?v?u4?N?|`?D?|U?mP?tŝ? ?u'?v?|U?m?}? P?i>Qc? ">u`?>t??P>>Ű>yy>R>դ3>)??P?i>Qc?>D'? ">u`??P>>Ű>դ3>)>Έ>??P?i>Qc?A>%o?>D'??P>>Ű>Έ>>Z8>??P?i>Qc?Š>C?A>%o??P>>Ű>Z8>>F>}??P?i>Qc?>t?Š>C??P>>Ű>F>}>yy>R??P>ϩ7>>դ3>)>yy>R>N>.P?=>?>t? ">u`?M>w P?r??tŝ? ?}? ?M?P?N=?}=< ?t6=;?r=P?>_,?-R>8 ? &1>??P?>_,?5>k^?-R>8 ??P?>_,? {>?5>k^??P?>_,?>? {>??P?>_,>>?>??P?>_,?K>L>>??P?>_,? g>R?K>L??P?>_,?>? g>R??P?>_,?2>?>??P?>_,? &1>?2>??P?$5>?-R>8 ?5>k^?>4P?>4?5>k^? {>?iT>/NP?iT>/N? {>?>>]>qP>1>?K>L? g>R?~>'P?~>'? g>R?>?> P?> ?>?2>?# >MDP?&s>v?# >MD?(>?,>e(P?=>?> ?# >MD?&s>vP?M>w ?~>'?> ?=>P>> >1>?~>'?M>w P>l>Y>>y3>6>1>>> P>>Hf>]>q>y3>6>l>Y>P?;j>?iT>/N>]>q>>HfP?+>GN?>4?iT>/N?;j>P?'e>س?$5>?>4?+>GNP?,>e(?(>?$5>?'e>سP?:>?r>?r>TP?r>G?r>?6>?4>8P?r>}?r>G?4>8?4>rP?r>r?r>}?4>r?7>rP?r>@?r>r?7>r?<>@P?r>?r>@?<>@?B>P?r=?r>?B>?N=P?r>?r??M??A>P?r>T?r>?A>?:><P>>)>>R? >VDP??P>>R>>)>."> x??P>>R>."> x>7> 0??P>>R>7> 0> >#$??P>>R> >#$>+>N??P>>R>+>N>¼>{0R??P>>R>¼>{0R>ϩ7>??P>>R>ϩ7>>N>.??P>>R>N>.>F>??P>>R>F>? >VDP??P?^O? :+?W? 6?UW?8?`?@)P?ƿ?<>?Z+?6-?5u??1??P?ƿ?<>??5?Z+?6-??P??5??/?Z+?6-??P??/?;?'?Z+?6-??P?P?U>%c>=4>}=3>re>/P?5+; =P>+<>=7>=?? =pP>=???=3? E=}? =pP?O^U>c?Ku=|x?J><??P?O^U>c?Rf=` ?Ku=|x??P?KV>?;>/?_4>??P?KV>?_4>?`>˃??P?Rf=` ?Rp˃?_4>?l>?lL>gP>FM=b>$=_>}=3>=4P>FM=b>=4>=>=P>=>=4>U>%c?>8P>U>%c>re>/?>&???P? E=}?=J? .m=8??P?E>? 7>*m?>t? ,>GP?[>b?_4>?;>/?<_>yP?pn>g?l>?_4>?[>bP?Yo>vӟ?[>b?<_>y?=Q2>ӲP?pn>MTD?pn>g?[>b?Yo>vӟP?Vͷ>G?Yo>vӟ?=Q2>Ӳ?<=F>p P?lso=G?pn>MTD?Yo>vӟ?Vͷ>GP?#=̮?)=`r?+z>Nj'?/ >DEP?cDE?; P?%=;{?c; ?C><CP?:5Y;Ļ?%=;{?. =?==P?Ku=|x?==?C><C?J><P?G<?:5Y;Ļ?==?Ku=|xP>h=V>=>=7><P?as=`X?a=>=>=?>=7P>=?>8??=3>=?P?>8?E>? ,>G??=3P?a> ?a=^?R^= ?RQ$> fP?_>?a6Y>Јj?U~Q>Јh?V>P?_>?V>?W>?^>hP?^?'?^>h?W>?W?#P?W>?V>?N>z?J">BP?W?#?W>?J">B?P?~P?P?~?J">B?DX>*?L6?_P?h!>vz?_>?^>h?k3>^FP?^?'?e|_??k3>^F?^>hP?r:`>\?k3>^F?e|_??i?ĎP????????????????????????????????????????????????????????????????????????????????????????????????????????????????????????????????????????????????????????????????????????????????????????????????????????????????????????????????????????????????????????????????????????????????????????????????????????????????????????????????????????????????????????????????????????????????????????????????????????????????????????????????????????????????????????????????????????????????????????????????????????????????????????????????????????????????????????????????????????????????????????????????????????????????????????????????????????????????????????DATA:` 9GGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGMEt2}oMECube.003Ў0{0{w@y@}vx zP 4?u?u?uDATAvw@DATAw@8?u?uuII?uuuIuuuu?uuI?u?u?uIII?u~u?uIIuu?uIu?u?uIIDATAxy@DATAy@5 ############DATAz{0UVTex{@Col}DATAx{04DATA{<????????????????????????DATA`}9|||hhh ||||||hhhhhh ME}2ՆPtMECube.004ЙՃՄՀՂՅ~Հ ՂP 4?u?u?uDATA~ՀDATAՀ8?u?uuII?uuuIuuuu?uuI?u?u?uIII?u~u?uIIuu?uIu?u?uIIDATAՀՂDATAՂ5 ############DATAՂՃUVTexՄ@ColՅDATAxՃ4DATAՄ<????????????????????????DATA`Յ9|||hhh ||||||hhhhhh MEՆP2Տ}MECube.005ХՌՍPՈՊՎՇՉ ՋP 4?u?u?uDATAՇՈDATAՈ8?u?uuII?uuuIuuuu?uuI?u?u?uIII?u~u?uIIuu?uIu?u?uIIDATAՉՊDATAՊ5 ############DATAՋՌUVTexՍP@ColՎDATAxՌ4DATAՍP<????????????????????????DATA`Վ9|||hhh ||||||hhhhhh MEՏ2՗ՆPMECube.006аՕpՖՑՓ՗@ՐPՒP Ք@P 4?u?u?uDATAՐPՑDATAՑ8?u?uuII?uuuIuuuu?uuI?u?u?uIII?u~u?uIIuu?uIu?u?uIIDATAՒPՓDATAՓ5 ############DATAՔ@ՕpUVTexՖ@Col՗@DATAxՕp4DATAՖ<????????????????????????DATA`՗@9|||hhh ||||||hhhhhh ME՗2ՠՏMECube.007м՞0՞՚@՜@ՠՙ՛ ՝P 4?u?u?uDATAՙ՚@DATA՚@8?u?uuII?uuuIuuuu?uuI?u?u?uIII?u~u?uIIuu?uIu?u?uIIDATA՛՜@DATA՜@5 ############DATA՝՞0UVTex՞@ColՠDATAx՞04DATA՞<????????????????????????DATA`ՠ9|||hhh ||||||hhhhhh MEՠ2թP՗MECube.008Ȁզէգեըագ եP 4?u?u?uDATAագDATAգ8?u?uuII?uuuIuuuu?uuI?u?u?uIII?u~u?uIIuu?uIu?u?uIIDATAգեDATAե5 ############DATAեզUVTexէ@ColըDATAxզ4DATAէ<????????????????????????DATA`ը9|||hhh ||||||hhhhhh MEթP2ղՠMECube.009PկհPիխձժլ ծP 4?u?u?uDATAժիDATAի8?u?uuII?uuuIuuuu?uuI?u?u?uIII?u~u?uIIuu?uIu?u?uIIDATAլխDATAխ5 ############DATAծկUVTexհP@ColձDATAxկ4DATAհP<????????????????????????DATA`ձ9|||hhh ||||||hhhhhh MEղ2պթPMECube.010 ոpչմնպ@ճPյP շ@P 4?u?u?uDATAճPմDATAմ8?u?uuII?uuuIuuuu?uuI?u?u?uIII?u~u?uIIuu?uIu?u?uIIDATAյPնDATAն5 ############DATAշ@ոpUVTexչ@Colպ@DATAxոp4DATAչ<????????????????????????DATA`պ@9|||hhh ||||||hhhhhh MEպ2տղMECylinder.025    ռս@ վp$9!>?>DATAռ DATA 8>; O >ο; =L| > ; >,uK; > vuvL; =L|RK ; ݰU>?G,ɽ9=9>>?G-=Lr{9>>?G->9=9>c%K?G->9>c%vO?G-=M9>K?G,ɫ9>0?=L/wB=Ly卽Ǟdu=LQĈ>d@=~>d둧@>e=L7:=卽8eaGxafRN¿>^`>}8>x>Y3ſ >:<8x>~4)4"DATAս@ DATA 59##### ## ## ## #### # # # ############# # # # # # ################ # # # # #DATAվp Col DATA 4!                 DATA 9MEտ2պMEPlanep    @P(AfAi?DATA DATA 8AfAcAfiffaAihAf6Afd66A;fh;fgAfA;`Af;lA;hAd;_Ahe;dbA;k;c56@A;fA;g`5;h;aA;hA;hA;c;e;fA;f;jDATA DATA 5( # # # # # # # # # #######!!!!!!!!!!!!! ! !!!!! !!! ! !DATA@VTexpUVTex @ColDATA@p4          DATA <p>>2.q>>(m?p>>>>?>>>2.q>q>>>?>>>>?>2q?@(m?>>>?@?2q?@>?@>?>?@>>?>???>?>?@??????>>q??.p??>?>?>??>?@>??>??.p??>?@>??>?>?>??@?>??>?@??????@?@???@??@????>?>????@??@???????DATA9@$$$!!!RRR&&&$$$RRR^^^RRR!!!###kkk^^^RRRkkkkkk)))&&&^^^JJJ )))JJJ444JJJ^^^kkkaaa444JJJaaa;;;kkk###444kkkkkkkkkkkkkkkkkk444 JJJkkkkkkJJJHHHaaakkkkkk^^^;;;aaa^^^111^^^kkkHHH===111^^^===)))ME2տMESphere.005ɀ0`P ːP2(+4?7'Ŭ?DATAPɀDATAPɀ8?PC??233,2?DATA0DATA005####DATAːVTexUVTex@Col`DATA4DATA,<????N DATA`9DNA1p SDNANAME/*next*prev*first*lastxyzwxminxmaxyminymax*pointergroupvalpadname[32]typesubtypeflagdatalentotallensaved*newid*libname[24]usicon_id*propertiesid*idblock*filedataname[240]filename[240]tot*parentcurvecurblocktypeshowkeyposcurvaladrcodetotelem*data*weightsvgroup[32]sliderminslidermax*refkeyelemstr[32]elemsizeblock*ipo*fromtotkeyslurph**scripts*flagactscripttotscript*line*formatblen*nameflagsnlineslines*curl*sellcurcselc*undo_bufundo_posundo_len*compiledsizeseekpassepartalphapad1clipstaclipendlensortho_scaledrawsizeshiftxshiftyYF_dofdistYF_apertureYF_bkhtypeYF_bkhbiasYF_bkhrotscriptlinkh*rectframenrframesoffsetsfrafie_imacyclokmulti_indexlayerpassmenunribufs*anim*rrsourcelastframetpageflagtotbindxrepyreptwstatwendbindcode*repbind*packedfile*previewlastupdatelastusedanimspeedgen_xgen_ygen_type*vnodetexcomaptomaptonegblendtype*object*texuvname[32]projxprojyprojzmappingofs[3]size[3]texflagcolormodelrgbkdef_varcolfacnorfacvarfacdispfacwarpfacname[160]*handle*pname*stnamesstypesvars*varstr*result*cfradata[32](*doit)()(*instance_init)()(*callback)()versionaipotype*ima*cube[6]imat[4][4]obimat[3][3]stypeviewscalenotlaycuberesdepthrecalclastsizenoisesizeturbulbrightcontrastrfacgfacbfacfiltersizemg_Hmg_lacunaritymg_octavesmg_offsetmg_gaindist_amountns_outscalevn_w1vn_w2vn_w3vn_w4vn_mexpvn_distmvn_coltypenoisedepthnoisetypenoisebasisnoisebasis2imaflagcropxmincropymincropxmaxcropymaxxrepeatyrepeatextendcheckerdistnablaiuser*plugin*coba*envloc[3]rot[3]mat[4][4]min[3]max[3]*obmodetotexenergydistspotsizespotblendhaintatt1att2shadspotsizebiassoftbufsizesampbuffersfiltertypebufflagbuftyperay_sampray_sampyray_sampzray_samp_typearea_shapearea_sizearea_sizeyarea_sizeztexactshadhalostepYF_numphotonsYF_numsearchYF_phdepthYF_useqmcYF_bufsizeYF_padYF_causticblurYF_ltradiusYF_glowintYF_glowofsYF_glowtypeYF_pad2*mtex[10]specrspecgspecbmirrmirgmirbambrambbambgambemitangspectraray_mirroralpharefspeczoffsaddtranslucencyfresnel_mirfresnel_mir_ifresnel_trafresnel_tra_ifiltertx_limittx_falloffray_depthray_depth_traharseed1seed2mode_lflarecstarclinecringchasizeflaresizesubsizeflarebooststrand_stastrand_endstrand_easesbiasshad_alphapadfrgbselpr_typeuse_nodespr_backpr_lampseptexml_flagdiff_shaderspec_shaderroughnessrefracparam[4]rmsdarkness*ramp_col*ramp_specrampin_colrampin_specrampblend_colrampblend_specramp_showpad3rampfac_colrampfac_spec*nodetree*groupfrictionfhreflectfhdistxyfrictdynamodepad2YF_arYF_agYF_abYF_dscaleYF_dpwrYF_dsmpYF_presetYF_djitname[256]scale*bbi1j1k1i2j2k2selcol1selcol2quat[4]expxexpyexpzradrad2s*mat*imatelemsdisp**mattotcolwiresizerendersizethreshvec[3][3]alfaweightradiush1h2f1f2f3hidevec[4]mat_nrpntsupntsvresoluresolvorderuordervflaguflagv*knotsu*knotsv*bp*beztcharidxkernnurb*bevobj*taperobj*textoncurve*path*keybevpathlenbevresolwidthext1ext2resolu_renresolv_renspacemodespacinglinedistshearfsizewordspaceulposulheightxofyoflinewidth*strfamily[24]*vfont*vfontb*vfonti*vfontbisepchartotboxactbox*tbselstartselend*strinfocurinfoname[128]maxrcttotrctvartypetotvertipoextraprtbitmask*drivereffect*mface*mtface*tface*mvert*medge*dvert*mcol*msticky*texcomesh*mselect*oc*sumohandlevdataedatafdatatotedgetotfacetotselectcubemapsizesmoothreshsubdivsubdivrsubsurftype*mr*pv*tpageuv[4][2]col[4]transptileunwrapv1v2v3v4edcodecreasedef_nr*dwtotweightco[3]no[3]co[2]indexv[4]midchildrenstartpad[2]v[2]*verts*faces*colfaces*edges*vert_edge_map*vert_face_map*map_memlevelslevel_countcurrentnewlvledgelvlpinlvlrenderlvluse_col*edge_flags*edge_creases*vert_map*edge_map*old_faces*old_edges*errormodifiersubdivTyperenderLevels*emCache*mCachedefaxispad[6]startlengthrandomizeseed*curve_ob*offset_oboffset[3]scale[3]merge_distfit_typeoffset_typecountaxistolerancesplit_angle*texturestrengthdirectiondefgrp_name[32]midleveltexmapping*map_objectuvlayer_name[32]uvlayer_tmp*projectors[10]*imagenum_projectorsaspectxaspectypercentfaceCount*objectcenterstartxstartyheightnarrowspeeddamptimeoffslifetimedeformflagparentinv[4][4]cent[3]falloff*indexartotindexforceoperationpntswopntsuopntsvopntswtypeutypevtypewfufvfwdudvdw*defvec[8][3]dvec[3]max**obpartypepar1par2par3parsubstr[32]*pardata*track*proxy*proxy_group*proxy_from*action*poseconstraintChannelsnetworkdefbasemodifiersdloc[3]orig[3]dsize[3]drot[3]dquat[4]obmat[4][4]laycolbitstransflagipoflagtrackflagupflagnlaflagprotectflagipowinscaflagscavisflagboundtypedupondupoffdupstadupendsfctimemassdampinginertiaformfactorsofttimerdampingsizefacdtdtxactcolempty_drawtypepad1[3]empty_drawsizepropsensorscontrollersactuatorsbbsize[3]actdefgameflaggameflag2softflaganisotropicFriction[3]constraintsnlastripshooks*pd*soft*dup_groupfluidsimFlagrestrictflagshapenrshapeflagpad4*fluidsimSettings*derivedDeform*derivedFinallastDataMaskcurindexactivedeflectforcefieldpdef_damppdef_rdamppdef_permf_strengthf_powermaxdistpdef_sbdamppdef_sbiftpdef_sbofttotpointtotspring*bpoint*bspringnodemassgravmediafrictrklimitphysics_speedgoalspringgoalfrictmingoalmaxgoaldefgoalvertgroupfuzzynessinspringinfrictefraintervallocalsolverflags**keystotpointkeysecondspringcolballballdampballstiffsbc_modeaeroedgeminloopsmaxloopschokepad5*scratchshow_advancedoptionsresolutionxyzpreviewresxyzrealsizeguiDisplayModerenderDisplayModeviscosityValueviscosityModeviscosityExponentgravxgravygravzanimStartanimEndgstarmaxRefineiniVelxiniVelyiniVelz*orgMesh*meshSurface*meshBBsurfdataPath[240]bbStart[3]bbSize[3]typeFlagsdomainNovecgenvolumeInitTypepartSlipValuegenerateTracersgenerateParticlessurfaceSmoothingsurfaceSubdivsunusedDNADummyparticleInfSizeparticleInfAlphafarFieldSize*meshSurfNormalsmistypehorrhorghorbhorkzenrzengzenbzenkambkfastcolexposureexprangelinfaclogfacgravityactivityBoxRadiusskytypephysicsEnginemisimiststamistdistmisthistarrstargstarbstarkstarsizestarmindiststardiststarcolnoisedofstadofenddofmindofmaxaodistaodistfacaoenergyaobiasaomodeaosampaomixaocolor*aosphere*aotableshemiresmaxiterdrawtypesubshootpsubshootenodelimmaxsublamppamapamielmaelmimaxnodeconvergenceradfacgammaselcolsxsy*lpFormat*lpParmscbFormatcbParmsfccTypefccHandlerdwKeyFrameEverydwQualitydwBytesPerSeconddwFlagsdwInterleaveEveryavicodecname[128]*cdParms*padcdSizeqtcodecname[128]codecaudio_codecvideo_bitrateaudio_bitrategop_sizerc_min_raterc_max_raterc_buffer_sizemux_packet_sizemux_ratemixratemainpad[3]*mat_override*light_overridelayflagpassflagpass_xor*avicodecdata*qtcodecdataffcodecdatacfraimagesframaptothreadsframelenblurfacedgeRedgeGedgeBfullscreenxplayyplayfreqplayattribrt1rt2stereomodedimensionspresetmaximsizexschyschxaspyaspxpartsypartswinposplanesimtypesubimtypequalityscemoderendererocresrpad[2]alphamodeosafrs_secedgeintsafetyborderdisprectlayersactlaygausspostmulpostgammaposthuepostsatdither_intensitybake_osabake_filterbake_modebake_flagGIqualityGIcacheGImethodGIphotonsGIdirectYF_AAYFexportxmlYF_nobumpYF_clamprgbyfpad1GIdepthGIcausdepthGIpixelspersampleGIphotoncountGImixphotonsGIphotonradiusYF_numprocsYF_raydepthYF_AApassesYF_AAsamplesGIshadowqualityGIrefinementGIpowerGIindirpowerYF_gammaYF_exposureYF_raybiasYF_AApixelsizeYF_AAthresholdbackbuf[160]pic[160]ftype[160]col[3]framename[64]*brushtoolcornertypeeditbutflagjointrilimitdegrstepturnextr_offsdoublimitsegmentsringsverticesunwrapperuvcalc_radiusuvcalc_cubesizeuvcalc_mapdiruvcalc_mapalignuvcalc_flagselect_threshimapaintclean_threshretopo_moderetopo_paint_toolline_divellipse_divretopo_hotspotpad4[3]dirairbrushview*sessiondrawbrushsmoothbrushpinchbrushinflatebrushgrabbrushlayerbrushbrush_typetexnrtexrepttexfadetexsepaveragingdraw_flagtablet_sizetablet_strengthsymm*camera*world*setbase*basactcursor[3]twcent[3]twmin[3]twmax[3]editbutsizeselectmodeproportionalprop_mode*ed*radioframing*toolsettingsaudiomarkersjumpframe*theDagdagisvaliddagflagssculptdatazoomblendximyimspacetypeblockscale*areablockhandler[8]viewmat[4][4]viewinv[4][4]persmat[4][4]persinv[4][4]winmat1[4][4]viewmat1[4][4]viewquat[4]zfacpad0persp*ob_centre*bgpic*localvd*ri*retopo_view_data*depthsob_centre_bone[32]localviewlayactscenelockaroundcamzoompivot_lastgridgridviewpixsizenearfarcamdxcamdygridlinesviewbutgridflagmodeselecttwtypetwmodetwflagtwdrawflagtwmat[4][4]clip[4][4]*clipbbafterdrawzbufxrayflag2gridsubdivsnap_target*properties_storageverthormaskmin[2]max[2]minzoommaxzoomscrollkeeptotkeepaspectkeepzoomoldwinxoldwinyrowbutv2d*editipoipokeyactname[32]constname[32]totipopinbutofschannellockmedian[3]cursenscuractaligntabomainbmainbo*lockpointexfromshowgroupmodeltypescriptblockre_alignoldkeypresstab[7]chanshown*filelisttotfiletitle[24]dir[160]file[80]ofssortmaxnamelencollums*libfiledataretvalmenuact(*returnfunc)()(*returnfunc_event)()(*returnfunc_args)()*arg1*arg2*menup*pupmenuoopsvisiflagtree*treestoresearch_string[32]search_tsesearch_flagsdo_outlinevisstoreflagdeps_flags*cumapimanrcurtileimtypenrshowsparecentxcenty*info_str*info_spare*spare*texttopviewlinesfont_idlheightleftshowlinenrstabnumbercurrtab_setshowsyntaxunused_paddpix_per_linetxtscrolltxtbar*scriptredraws*idaspect*curfont*edittreetreetypetitle[28]fasesubfasemouse_move_redrawimafasemxmydirslidirsli_linesdirsli_sxdirsli_eydirsli_exdirsli_himaslifileselmenuitemimasli_sximasli_eyimasli_eximasli_hdssxdssydsexdseydesxdesydeexdeeyfssxfssyfsexfseydsdhfsdhfesxfesyfeexfeeyinfsxinfsyinfexinfeydnsxdnsydnwdnhfnsxfnsyfnwfnhfole[128]dor[128]file[128]dir[128]*firstdir*firstfiletopdirtotaldirshilitetopfiletotalfilesimage_sliderslider_heightslider_spacetopimatotalimacurimaxcurimay*first_sel_ima*hilite_imatotal_selectedima_redraw*cmapoutline[4]neutral[4]action[4]setting[4]setting1[4]setting2[4]num[4]textfield[4]textfield_hi[4]popup[4]text[4]text_hi[4]menu_back[4]menu_item[4]menu_hilite[4]menu_text[4]menu_text_hi[4]but_drawtypeiconfile[80]back[4]header[4]panel[4]shade1[4]shade2[4]hilite[4]grid[4]wire[4]select[4]lamp[4]active[4]group[4]group_active[4]transform[4]vertex[4]vertex_select[4]edge[4]edge_select[4]edge_seam[4]edge_sharp[4]edge_facesel[4]face[4]face_select[4]face_dot[4]normal[4]bone_solid[4]bone_pose[4]strip[4]strip_select[4]vertex_sizefacedot_sizebpad[2]syntaxl[4]syntaxn[4]syntaxb[4]syntaxv[4]syntaxc[4]movie[4]image[4]scene[4]audio[4]effect[4]plugin[4]transition[4]meta[4]bpad1[4]tuitbutstv3dtfiletipotinfotsndtacttnlatseqtimatimaseltexttoopsttimetnodebpad[4]spec[4]dupflagsavetimetempdir[160]fontdir[160]renderdir[160]textudir[160]plugtexdir[160]plugseqdir[160]pythondir[160]sounddir[160]yfexportdir[160]versionsvrmlflaggameflagswheellinescrolluiflaglanguageuserprefviewzoomconsole_bufferconsole_outmixbufsizefontsizeencodingtransoptsmenuthreshold1menuthreshold2fontname[256]themesundostepscurssizetb_leftmousetb_rightmouselight[3]tw_hotspottw_flagtw_handlesizetw_sizetextimeouttexcollectratememcachelimitframeserverportpad_rot_angleobcenter_diarvisizervibrightversemaster[160]verseuser[160]vertbaseedgebaseareabase*sceneendxendysizexsizeyscenenrscreennrfullmainwinwinakthandler[8]*newvvec*v1*v2panelname[64]tabname[64]drawname[64]ofsxofsycontrolsnapold_ofsxold_ofsysortcounter*paneltab*v3*v4*fullwinmat[4][4]headrctwinrctheadwinwinheadertypebutspacetypewinxwinyhead_swaphead_equalwin_swapwin_equalheadbutlenheadbutofscursorspacedatauiblockspanelssubvstr[4]subversionpadsminversionminsubversiondisplaymode*curscreen*curscenefileflagsglobalfname[80]*ibuf*se1*se2*se3nrdone*stripdataorxory*instance_private_data**current_private_data*newseqstartofsendofsstartstillendstillmachinestartdispenddispmulhandsize*strip*curelemfacf0facf1*seq1*seq2*seq3seqbase*sound*hdaudiolevelpancurposstrobe*effectdataanim_preseek*oldbasep*parseq*seqbasepmetastackedgeWidthangleforwardwipetypefMinifClampfBoostdDistdQualitybNoCompScalexIniScaleyIniScalexFinScaleyFinxInixFinyIniyFinrotInirotFin*frameMapglobalSpeedbuttypeuserjitstaendtotpartnormfacobfacrandfactexfacrandlifeforce[3]vectsizemaxlendefvec[3]mult[4]life[4]child[4]mat[4]texmapcurmultstaticstepomattimetexspeedtexflag2negvertgroup_vvgroupname[32]vgroupname_v[32]*keysminfacusedusedelemdxdylinkotypeold*poin*oldpoinresetdistlastval*makeyqualqual2targetName[32]toggleName[32]value[32]maxvalue[32]materialName[32]damptimerdelaypropname[32]matname[32]axisflag*fromObjectsubject[32]body[32]pulsefreqtotlinks**linksinvertfreq2axisfbuttonbuttonfhathatfprecisionstr[128]*mynewinputstotslinks**slinksvalotime*actblendinprioritystrideaxisstridelengthsndnrpad1[2]makecopycopymadepad2[1]trackvolume*melinVelocity[3]localflagforceloc[3]forcerot[3]linearvelocity[3]angularvelocity[3]butstabutendminfacvisifacslowminloc[3]maxloc[3]minrot[3]maxrot[3]distributionint_arg_1int_arg_2float_arg_1float_arg_2toPropName[32]*toObjectbodyTypefilename[64]loadaniname[64]goaccellerationmaxspeedmaxrotspeedmaxtiltspeedrotdamptiltdampspeeddamp*sample*stream*newpackedfile*snd_soundpanningattenuationpitchmin_gainmax_gaindistancestreamlenchannelshighpriopad[10]gaindopplerfactordopplervelocitynumsoundsblendernumsoundsgameengine*lamprengobjectchildbaserollhead[3]tail[3]bone_mat[3][3]arm_head[3]arm_tail[3]arm_mat[4][4]xwidthzwidthease1ease2rad_headrad_tailbonebasechainbasepathflaglayer_protectedghostepghostsizeghosttypepathsizeghostsfghostefpathsfpathefconstflagikflagselectflag*bone*childiktree*b_bone_matschan_mat[4][4]pose_mat[4][4]pose_head[3]pose_tail[3]limitmin[3]limitmax[3]stiffness[3]ikstretch*customchanbaseproxy_layerstride_offset[3]cyclic_offset[3]reserved1autosnapactnractwidthtimeslidename[30]enforce*tariterationsrootbonesubtarget[32]orientweightgrabtarget[3]reserved2minmaxflagstickystuckcache[3]lockflagfollowflagzminzmaxvolmodeplaneorglengthbulgepivXpivYpivZaxXaxYaxZminLimit[6]maxLimit[6]extraFzchannel[32]no_rot_axisstride_axiscurmodactstartactendactoffsstridelenrepeatblendoutstridechannel[32]offs_bone[32]hasinputhasoutputdatatypesockettypenslimitstack_indexinternstack_index_extlocxlocyown_indexto_index*tosock*link*new_nodelastyoutputs*storageminiwidthcustom1custom2need_execexectotrbutrprvr*typeinfo*fromnode*tonode*fromsocknodeslinks**stackinitstacksizecur_index**alltypes*owntype(*timecursor)()(*stats_draw)()(*test_break)()cyclicmoviesamplesminspeedbokehhuesatt1t2t3fstrengthfalphakey[4]colname[32]bktyperotationpreviewgamcono_zbuffstopmaxblurbthreshshortymintablemaxtableext_in[2]ext_out[2]*curve*table*premultablecurrcliprcm[4]black[3]white[3]bwmul[3]offset[2]innerradiusratergb[3]clone*layerstotlayermaxlayertotsizeTYPEcharucharshortushortintlongulongfloatdoublevoidLinkListBasevec2svec2ivec2fvec2dvec3ivec3fvec3dvec4ivec4fvec4drctirctfIDPropertyDataIDPropertyIDLibraryFileDataIpoKeyBlockKeyScriptLinkTextLineTextPackedFileCameraPreviewImageImageUserImageanimRenderResultMTexObjectTexPluginTexCBDataColorBandEnvMapImBufTexMappingLampWaveMaterialbNodeTreeGroupVFontVFontDataMetaElemBoundBoxMetaBallBezTripleBPointNurbCharInfoTextBoxCurvePathIpoDriverIpoCurveMeshMFaceMTFaceTFaceMVertMEdgeMDeformVertMColMStickyMSelectOcInfoCustomDataMultiresPartialVisibilityMDeformWeightMultiresColMultiresColFaceMultiresFaceMultiresEdgeMultiresLevelMultiresMapNodeModifierDataSubsurfModifierDataLatticeModifierDataCurveModifierDataBuildModifierDataArrayModifierDataMirrorModifierDataEdgeSplitModifierDataDisplaceModifierDataUVProjectModifierDataDecimateModifierDataWaveModifierDataArmatureModifierDataHookModifierDataSoftbodyModifierDataBooleanModifierDataLatticebDeformGroupLBufbActionbPosePartDeflectSoftBodyFluidsimSettingsDerivedMeshObHookSBVertexBodyPointBodySpringSBScratchWorldRadioBaseAviCodecDataQuicktimeCodecDataFFMpegCodecDataAudioDataSceneRenderLayerRenderDataGameFramingTimeMarkerImagePaintSettingsBrushToolSettingsBrushDataSculptDataSculptSessionSceneDagForestBGpicView3DSpaceLinkScrAreaRenderInfoRetopoViewDataViewDepthsView2DSpaceInfoSpaceIpoSpaceButsSpaceSeqSpaceFiledirentryBlendHandleSpaceOopsTreeStoreTreeStoreElemSpaceImageCurveMappingSpaceNlaSpaceTextSpaceScriptScriptSpaceTimeSpaceNodeSpaceImaSelImaDirOneSelectableImaThemeUIThemeSpacebThemeSolidLightUserDefbScreenScrVertScrEdgePanelFileGlobalStripElemStripPluginSeqSequencebSoundhdaudioMetaStackEditingWipeVarsGlowVarsTransformVarsSolidColorVarsSpeedControlVarsEffectBuildEffPartEffParticleWaveEffOopsbPropertybNearSensorbMouseSensorbTouchSensorbKeyboardSensorbPropertySensorbCollisionSensorbRadarSensorbRandomSensorbRaySensorbMessageSensorbSensorbControllerbJoystickSensorbExpressionContbPythonContbActuatorbAddObjectActuatorbActionActuatorbSoundActuatorbCDActuatorbEditObjectActuatorbSceneActuatorbPropertyActuatorbObjectActuatorbIpoActuatorbCameraActuatorbConstraintActuatorbGroupActuatorbRandomActuatorbMessageActuatorbGameActuatorbVisibilityActuatorFreeCamerabSamplebSoundListenerSpaceSoundGroupObjectBonebArmaturebPoseChannelbActionChannelSpaceActionbConstraintChannelbConstraintbKinematicConstraintbTrackToConstraintbRotateLikeConstraintbLocateLikeConstraintbMinMaxConstraintbSizeLikeConstraintbActionConstraintbLockTrackConstraintbFollowPathConstraintbDistanceLimitConstraintbRotationConstraintbStretchToConstraintbLocLimitConstraintbRotLimitConstraintbSizeLimitConstraintbRigidBodyJointConstraintbActionModifierbActionStripbNodeStackbNodeSocketbNodeLinkbNodebNodePreviewbNodeTypeNodeImageAnimNodeBlurDataNodeHueSatNodeImageFileNodeChromaNodeGeometryNodeVertexColNodeDefocusCurveMapPointCurveMapBrushCloneCustomDataLayerTLEN  L4(Thxh txT8lDDlh8$88T,< @ @ 44DX`Dl<<<``4@t( <(,((0@PP Ll<$x$(h x  8x h (88,@0,HhH,(lDLP@< <@Lh48<8l(DlP<,4D4,,D,@,<4`4$t (@  ,4STRC                 !"#$ %&'( )*+, -./01 234* 56789 :;<=!!!>?@" ABC D!E!FGHIJK L#MNB -$OPQRSTUVWXYZ[\6 ]%^_& `abcdefghij'! k(l)mfnPopqrstuvw#x%yz{|}~ *+,-   .)&/#&.0+'1QRfo,4dabc&6'-/02+34QR  * 6 ]465e   !"#$%&'()*+,-./0123456789:;<=>?@ABCDEFGH/I/JKLMNOPQR* 6S67TUVWXYZ[\]^_`abc ]8de9-#x:::;fghijklmnopqrstuvw<;f x y65z{|}~= >???>=@[A^B9;f  y+++6C5z {[D)8888A@@D+'+EEE>='+  *DF);f 65zGHIJKLMNFOP QQQ[{RS I GKTLTJMNOH'UVUWXY YYJWVX  ZR   QQ  S GK[[[\[B  ][+^[+_[` [++ !"#B$a[%&b['Bc [,()*+,-+./0d [+1'2B345/0e[67f [+89:;<=>?@g[AP[++h [+BCDEFGi[j[+HkIJKL[MNOPQRSTU>V6Llll;WPXm#Y+Z+h[\]^_ `+$+a+b+c+d6C;fneof - g  h y i j5zklmnoopBqrstuvwxyz{|}~{ ]        pq7rss ttt+$BCDEFGp uq(vwcu8Pxr(FFF6Jy9      !"#$%&'()*+,6* ]z-./0123456789:;{{{q<=>+| ? @ABCDEFGHIJ} K LM[N~ OPQRSBTUVWXYZ[ 5\7]q^_`c|a}b~cdcefghijklmnopqrstuMvwxyz{|}~ [P[PP[M)* %+y' {q=6S z  ] P[P '&MD     ++/q !"PS#$%&'()*+,-j./0123;4 56789:[ ;#&<=>?@ABCDEFGH         I[J K L67MNOPQR('jST#   UVWXJYjPZ [\]^_z`ab   JYc[   defghijklmnop q r s t uvw   J xPy [ z{|}~   J'2&jS[1    jSJ   "Bj   [Bj  J  J7j 6S6Q  [1 q t[0      !"#$%&'()*+,-./0123456789:;*<2=>?@ABCDEFGHIJKLMNOPQRSTUVWX YZ[\]^_`abcdefghijkl m n op9q:rstuvwxyz{ |}~st}~ ]    }  1f g d     ) c6p(l       Bc-@8>8y7T9:;<=>?@, -        P[5>[ % P +!"# $%&P[ -'+() %*+,-./0"12& 3[P -'456+ n789:; <=>?@<AB 6+FCDEp++ FGknHI P&JK+;LYM%N>OPQRS [&JK7TTUVWXY+Z"[P[#\] 1 ^ -+ _`abcdef g#x#h i6BjklmnoBpqrstuvwx  J<S[+ y7 zh$ {|}~h  /Ah x[$  o+o 6 gn    JnePS6 - ++B++ +bP[+ +LYn7+u+buv+P[o   +   8   P   P++P[+6n7+:8 jLY -Pj 2   y 6        ac st`PM;[ dOc      e   & !"#$%:'2& M'()* *b -Q+,-.ENDB