BLENDER_v249REND dSceneGLOB X 2`@|[}!SRx4y`@|SR1-Animation4yX8y8y>y?y5|[} DATA4y4yDATA4y@5y4y DATA@5y5y4y DATA5y5y@5yDATA5y6y5yDATA6y`6y5yDATA`6y6y6yDATA6y6y`6yDATA6y87y6yDATA87y7y6yDATA7y7y87yDATA7y8y7yDATA8yX8y7yDATAX8y8yDATA8y8y4y@5yDATA8y09y8y4y5yDATA09yx9y8y4y6yDATAx9y9y09y@5y`6yDATA9y:yx9y6y`6yDATA:yP:y9y5y6yDATAP:y:y:y`6y6yDATA:y:yP:y6y6yDATA:y(;y:y5y`6yDATA(;yp;y:y4y87yDATAp;y;y(;y5y7yDATA;yy=y5y7yDATA@>y>y=y7yX8yDATA>y>y@>y6y87yDATA>y>y8yX8yDATA?y|4y87y7y5yOx||@ |`|DATA@ |X |Link and MaterialsEditing>DATAX |p|@ |MeshEditingF>DATAp||X |Anim settingsObject>DATA||p|DrawObjectF>DATA|||ConstraintsObject>DATA|||EffectsObjectDATA|||HooksObjectF>|DATA|||Particle InteractionObject>|DATA|||SoftbodyObject>|DATA|0||OutputRender>DATA0|H||RenderRenderF>DATAH|`|0|AnimRender>DATA`|H|FormatRender>DATAx||333?@DhCDhCC(BDC?z?DATA|x|333?/9DATA||?y6y4y@5y`6y !  DATA|#||7y8y6y6yG==o?`!|| |DATA| |Transform PropertiesView3d>DATA ||3D Viewport propertiesView3d>"DATA`!|333?????????G==o? A*A?G==o??????*A} B??=C ݢM@ݢM@ݢM@? DATA!|`333?/9DATA#|.||6y6y`6y5y??PףH%|,|$|$|DATA$|Transform PropertiesIpo!>DATAX%|H'|333? zC̽̌?zC@ #< #<`jFzD }OBzC̽̌?DATAH'|Nf%|333? CC|||??l|DATANfjH'| 333? zCCHBC|||?CFC= ADATAj6fNf 333?  =rttDATA6f(|j 333? ?zDzDBCl||ll|zDzD=HB DATA(|p)|6f 333? BzB@l|llFzD #<HB DATAp)|,|(|333? ??? ???? A???PA A!O?j?}GCHB? A} B? #<C DATA,|p)|333? /9DATA.|5|#|X8y7y5y7y 1|3|/|0|DATA/|0|Link and MaterialsEditing>DATA0|/|MeshEditingF>DATA1|F333?J zCB{ µCB ?BFB= ADATAF2|1| 333?J zCCHBC$?CFC= ADATA2|3|F333?J #DhC`DpJgChCC(BDC?z?DATA3|2|333?J /9DATA5|.|87y6y8yX8y} ?=o?.8|h>|6|7|DATA6|7|Transform PropertiesView3d>DATA7|6|3D Viewport propertiesView3d>"DATA8|;|333? K|8|333? K????????} ?=o?f?*A?} ?=o??????*A} B??=C X7@X7@X7@? DATAh>|;|333? K/9SRx`@| |4ySR2-Model A|C|C|G|H||[};DATAA|PA|DATAPA|A|A|DATAA|A|PA|DATAA|(B|A|DATA(B|pB|A|XDATApB|B|(B|XDATAB|C|pB|DATAC|HC|B|DATAHC|C|C|DXDATAC|HC|DDATAC| D|PA|A|DATA D|hD|C|A|A|DATAhD|D| D|A|(B|DATAD|D|hD|A|pB|DATAD|@E|D|(B|pB|DATA@E|E|D|PA|B|DATAE|E|@E|A|C|DATAE|F|E|B|C|DATAF|`F|E|(B|B|DATA`F|F|F|pB|C|DATAF|F|`F|(B|HC|DATAF|8G|F|pB|HC|DATA8G|G|F|B|C|DATAG|G|8G|C|C|DATAG|G|HC|C|DATAH||A|(B|pB|A|?@PףW=W<=O||fxXwI|؀|DATAI|(J|PreviewLamp>DATA(J|@K|I|LampLampF>DATA@K|XL|(J|SpotLamp>DATAXL|pM|@K|Texture and InputLamp>DATApM|N|XL|Map ToLamp>XL|DATAN|O|pM|PreviewMaterial>DATAO|P|N|MaterialMaterialF>DATAP|Q|O|PreviewWorld>DATAQ|R|P|WorldWorldF>DATAR|T|Q|Mist Stars PhysicsWorld>DATAT|U|R|Texture and InputWorld>DATAU|0V|T|Map ToWorld>T|DATA0V|HW|U|OutputRender>DATAHW|`X|0V|RenderRenderF>DATA`X|xY|HW|AnimRender>DATAxY|Z|`X|FormatRender>DATAZ|[|xY|Link and MaterialsEditing>+DATA[|\|Z|MeshEditingF>+DATA\|]|[|Mesh ToolsEditing>(DATA]|^|\|Mesh Tools 1Editing>DATA^|`|]|CameraEditingF>DATA`| a|^|ShadersMaterial>pp|DATA a|8b|`|TextureMaterial>DATA8b|Pc| a|Anim settingsObjectF>DATAPc|hd|8b|DrawObject>DATAhd|e|Pc|ConstraintsObject>DATAe|f|hd|ScriptlinksScript>DATAf|g|e|EffectsObjecthd|DATAg|h|f|Map InputMaterial> a|DATAh|i|g|Map ToMaterial> a|DATAi|j|h|AnimAnim>DATAj|l|i|SoundSound>DATAl|(m|j|ListenerSoundF>DATA(m|@n|l|SequencerSound>DATA@n|Xo|(m|ArmatureEditingF>DATAXo|pp|@n|RampsMaterialF>O|DATApp|q|Xo|Mirror TranspMaterial>DATAq|r|pp|Mist / Stars / PhysicsWorld>DATAr|s|q|Amb OccWorld>q|DATAs|t|r|Shadow and SpotLamp>DATAt|u|s|ModifiersEditing>+DATAu|w|t|ShapesEditing>+t|DATAw|x|u|MultiresEditing>+DATAx|0y|w|Mesh Tools MoreEditing^>(DATA0y|Hz|x|UV CalculationEditing>(w|DATAHz|`{|0y|PaintEditing>"DATA`{|x||Hz|Object and LinksObject>DATAx||}|`{|Texture FaceEditing>w|DATA}|~|x||Render LayersRender>0V|DATA~||}|BakeRender>`X|DATA|؀|~|StampRender>xY|DATA؀||Links and PipelineMaterialF>DATA||333?H|DhC/D~hCC(BDC?z?=~mDATA|P||333?H|??? ???? A??@PA Aj?c3>}GCHB? A} B? #<C DATAP|||333?H|HE}CHE}C HE}C??DATA|P|333?H|/9DATA||H|B|PA|A|C|zlDATA|||HC|C|C|pB|9N?? JLEYEYsEt 4`||jj||DATA||Transform PropertiesView3d,>DATA||View PropertiesView3dT>"DATA`||333?|CCC$)N@69@4dz+> C@DATA||`| 333?|8}. [><B(DATAX| ||333?|?Be@ dCF"@ #< #<`jFzD y}}OB?Be@DATA |p||333?|q?xPֽ>9>->f;wt?v>,x?q?9>;bPֽ->wt?>f{>kA.{ 4A?!?h󟠾?聛>g?f??>[0т; ý>9_?@5p XB8>NB8V=BS @9N?? JLq?xPֽ>9>->f;wt?v>,x?FK?&Ž_g `A`A} B??Px;=C)b26>7?X<???? ?DATAp|| |333?|HEVDHEVD2 XHEVD??2DATA||p| 333?|?zDzB@22FzD #<HB DATA|||333?|DdC8CnD fCC(BDC?z?DATA||333?| Open ImageT PICTURESC:\Documents and Settings\Lanz\Desktop\for blender presentation\universe XYZ\texture_starChar_background.psd DATA||(B|B|C|HC|?>`@AHMCYCYsCt D4М|(|hh||DATA||Transform PropertiesView3d,>DATA||View PropertiesView3dT>"DATAМ|(|333?|kz?e vQ>ǖT>>>uisb{?A>:9X ?kz?T>@hsa >>b{?vQ>u|A>I?{???a`QvQ(H>>\v?u?蚘@AAMj9?r@ @G?/)>"Bp=j>1]AS:ן@Ҟ@$)@?>`@AHMkz?e vQ>ǖT>>>uisb{?A>:9X ?OWD?%"bh҈B~B} B??bs:=C@Ƽ@tA7?X<???? G?1oнDATAX(||М|333?|zC̽̌?zC@22 #< #<`jFzD }OBzC̽̌?DATA|(|(|333?|HEVDHEVD2 XHEVD??2|Ȥ|DATA,|H|BOq= }DATA,H|||EM@|A~DATA,||H|AM1~Ab>A~DATA,|h||BO`A(}DATA,h|Ȥ||BOp=A}DATA,Ȥ|h|CS@ff[}DATA(||| 333?|?zDzB@22FzD #<HB DATA|(|(|333?|DdC8CnD fCC(BDC?z?DATA(||333?|OpenAseNT PICTURESC:\Documents and Settings\Lanz\Desktop\for blender presentation\universe XYZ\starChart.blendlendtSRx |x|`@|SR3-Materialodel Singȩ|p|||0||[} DATAȩ||DATA|X|ȩ| DATAX||| DATA||X|DATA|0||<DATA0|x||<DATAx||0|DATA||x|DATA|P||,<DATAP|||,DATA||P|DATA|(||,DATA(|p||DATAp|(|DATA|||X|DATA|H||ȩ||DATAH|||ȩ||DATA|خ|H||0|DATAخ| |||0|DATA |h|خ||x|DATAh|| |X||DATA||h|x||DATA|@||0||DATA@|||||DATA|а|@|0||DATAа||||P|DATA|`|а||P|DATA`|||||DATA||`|x||DATA|8||P||DATA8|||||DATA|Ȳ|8|||DATAȲ||||(|DATA|X|Ȳ||(|DATAX|||x|p|DATA||X|P|p|DATA||(|p|DATA0||ȩ||0||?@Pף;;!||0|x|DATA0|H|OutputRender>DATAH|`|0|RenderRenderF>DATA`|x|H|AnimRender>DATAx|`|FormatRender>DATA|h|333? ~CA~CA!?AFA= ADATAh|H|| 333? zCCHBC ?CFC= ADATAH|X|h|333? DhC?DhCC(BDC?z?mDATAX||H|333? ??? ???? A??@PA Aj?c3>}GCHB? A} B? #<C DATA||X|333? @̌AR|B1@lA A@CC #<@DATA||333? /9DATA||0|x||X|| !  DATA||||P||0|G@? JL-=-=W-X~||||DATA||OutputRender>DATA|||RenderRender>DATA| ||AnimRender0>DATA |8||FormatRenderH>DATA8|P| |PreviewMaterial>DATAP|h|8|MaterialMaterial>DATAh||P|ShadersMaterial0>DATA||h|TextureMaterialD>DATA|||Map InputMaterial\>DATA|||Map ToMaterial`>DATA|||RampsMaterial>P|DATA||Mirror TranspMaterialH>DATA||333?*ChCCvgCC(BDC?z?DATA|X||333?*J>H!?)xu?i6>Pbܗ=(?^L?a?滎z?J>#xu?ܗ=Hi6>(? ?Pb^L?\FAA?4[?[!?@jG>gb>Pb>4Im>k&?]M^L<0@AzA=>Kc<2֍7&> ?:x¸A1vB,jB~@G@? JLJ>H!?)xu?i6>Pbܗ=(?^L?a?滎z?@?$$OA} B?=Ch?j(4?t'>d DATAXX|||333?*zC AzC A #< #<`jFzD OBDATA|X|333?*;SAVE FILE/usr/home/intrr/blender/blend/untitled.blendDATA|||||||U.=w=o?+=+=W+X,X||DATA|(|333????h?j(4?t'>????hj(4t'?U.=w=o??OA} B??=Ch?j(4?t'>dEh@Eh@Eh@? DATA(|8||333?DdC>9C,DeCC(BDC?z?DATAX8||(|333?zC AzC A #< #<`jFzD OBDATA|8|333? SAVE FILE/Users/ton/Desktop/der/blend/untitled.blendDATA|||(|p|P||e?B$?AHM+++US||DATA||333?ݕ/?U~'?3F:?>T8165e?2>Z& 4?ߕ/?7F:?81W~>85e?'?T2>ne@>M@?4z?'''䷄?K??T?v|@?l211A 4Atp>?@@FC>G ?4xB֟&BĭeA(@e?B$?AHMݕ/?U~'?3F:?>T8165e?2>Z& 4?H?N,Z#OA} B??=Ch?j(4?t'>dA@A@A@? DATA|||333?DdC>9C,DeCC(BDC?z?DATAX|||333?zC AzC A #< #<`jFzD OBDATA||333? SAVE FILE/Users/ton/Desktop/der/blend/untitled.blendDATA|||x|p|(|&=+=o?US||DATA||333?*?3?3:-vk(4??3?3;@k(40v@?&=PU1n;+=ꉖø;ZO{:?JXA54U0AC;@j(40v@?&=+=o??3?3:-vk(4?5?5IXA} B??=C:j(4?.vdٚ@ٚ@ٚ@? DATA|||333?*DdC>9C,DeCC(BDC?z?DATAX|||333?*zC AzC A #< #<`jFzD OBDATA||333?* SAVE FILE/Users/ton/Desktop/der/blend/untitled.blendSRxx|&} |SR4-Sequence |||||}[} DATA |h|DATAh|| | DATA||h| DATA|@||DATA@|||DATA||@|DATA|||DATA|`||DATA`|||DATA||`|DATA|8||TDATA8|||TDATA||8|DATA||DATA|X|h||DATAX||| ||DATA||X| |@|DATA|0||||DATA0|x||@||DATAx||0|h||DATA||x|||DATA|P||||DATAP||||`|DATA||P|||DATA|(||`||DATA(|p||`||DATAp||(|||DATA||p||8|DATA|H|||8|DATAH||||8|DATA||H|@||DATA| ||`||DATA |h||||DATAh|| |||DATA|h|||DATA|`} |@|||X}h}|@}DATA|}OutputRender>DATA}(}|RenderRenderF>DATA(}@}}AnimRender>DATA@}(}FormatRender>DATAX}h}333?ʃDhCvDhCC(BDC?z?DATAh}X}333?ʃ/9DATA`}`}||h||| !  DATA`}x}`}@||||8=i>o? ` }}DATA` }8 }333?ʄ~CB~CB ?BFB= ADATA8 }0 }` }333?ʄzCAzCA  A@FB= A ?DATA0 }}8 }333?ʄ????????8=i>o?fffAD&@??fffA} B? #<C DATA}0 }333?ʄAVE TARGA/t1.blend9DATAx}}`}|8|||8=H>o?UUU x}}DATAx}p}333?JzCAzCA1||1 A@FB= A ?DATAp}}x}333?J????????8=H>o?fffA*@??fffA} B? #<C DATA}p}333?JAVE TARGA/t1.blend9DATA}}x}`||8||8=>o?SSST}}DATAX}@}333?ʅB̽̌?B̽̌? #< #<`jFzD SQB̽̌?DATA@}}}333?ʅ????????8=>o?fffA@??fffA} B? #<C DATA}@}333?ʅOAD FILE/9DATA}}|`|||8=i>o?  }$}DATA }!}333?*zCAzCA A@FB= A ?DATA!}$} }333?*????????8=i>o?fffAD&@??fffA} B? #<C DATA$}!}333?*AVE TARGA/t1.blend9SRx&}x|SR5-Scriptingp'})}@*}0.}x.}0H}[} DATAp'}'}DATA'}(}p'} DATA(}H(}'} DATAH(}(}(}DATA(}(}H(}DATA(} )}(}DATA )}h)}(}DATAh)})} )}DATA)})}h)}DATA)})}DATA@*}*}'}(}DATA*}*}@*}'}(}DATA*}+}*}(} )}DATA+}`+}*}(} )}DATA`+}+}+}(}h)}DATA+}+}`+}(})}DATA+}8,}+} )})}DATA8,},}+}h)})}DATA,},}8,}(}(}DATA,}-},}p'}(}DATA-}X-},}p'})}DATAX-}-}-}H(})}DATA-}-}X-}h)})}DATA-}0.}-})})}DATA0.}-}H(} )}DATAx.}x/}(}'}(} )} !  DATAx/}7}x.}(}(})}h)}z==o?2}5}x0}1}DATAx0}1}Transform PropertiesView3d>DATA1}x0}3D Viewport propertiesView3d>"DATA2}5}333? ˅????????z==o?&A*A?z==o??????*A} B??=C ?@?@?@? DATA5}2}333? ˅/9DATA7}0H}x/})})} )}H(}??Pף L:}8F}8}8}DATA8}Transform PropertiesIpo!>DATA:}:} 333? > =DATA:};}:}333? CCx??|?DATAX;}x=}:}333? zC̽̌?zC@;; #< #<`jFzD }OBzC̽̌?DATAx=}0@};}333? CC|||??l|>}?}DATA,>}?}BO`A(}DATA,?}p?}>}BOp=A}DATA,p?}?}?}BOq= }DATA,?}p?}EMA~DATA0@}A}x=} 333? zCCHBC|||?CFC= ADATAA}A}0@} 333? ?zDzDBCl||ll|zDzD=HB DATAA}B}A} 333? BzB@l|llFzD #<HB DATAB}8F}A}333? ??? ???? A???PA A!O?j?}GCHB? A} B? #<C DATA8F}B}333? /9DATA0H}7}p'}(}h)})}OX}Y}0I}hW}DATA0I}HJ}Link and MaterialsEditing>DATAHJ}`K}0I}MeshEditingF>DATA`K}xL}HJ}Anim settingsObject>DATAxL}M}`K}DrawObjectF>DATAM}N}xL}ConstraintsObject>DATAN}O}M}EffectsObjectDATAO}P}N}HooksObjectF>xL}DATAP}Q}O}Particle InteractionObject>M}DATAQ}S}P}SoftbodyObject>M}DATAS} T}Q}OutputRender>DATA T}8U}S}RenderRenderF>DATA8U}PV} T}AnimRender>DATAPV}hW}8U}FormatRender>DATAhW}PV}ScriptlinksScript>DATAX}Y}333? ChC#DhCC(BDC?z?DATAY}X}333? /9SC|[}SCScenetageain}H}8a}c}xb}+@>B?(L"N 4͐,Y&Y͐(Y>0Y>͐=hc}c}dd??< d XZ! ??f}f}BB?????//backbuf/tmp\L?L?L??>??_??D uhd}DATA8a}{a}"(}DATAa}{a}8a}}DATAa}{(b}a}.,}DATA(b}{xb}a}Zj}DATAxb}{b}(b}"}DATAb}{c}xb}.-(}DATAc}{b}. }DATA(hc}z,d'=A@DATAc}L?B ?o: ??XP22 2d 22 22 22 22 22 > #<===ff??AHz?=???CDATAd}'????C?N #,=P +=f}??????DATAHf}%?=Vy?>`fff?Ou<?DATAHf}1 RenderLayerIM8j IMtexture_starChar_back6C:\Documents and Settings\Lanz\Desktop\for blender presentation\universe XYZ\texture_starChar_background.psdg}9??DATA g} Pg}DATAPg}gggiiiIII<<<;;;NNN{{{...+++CAw}CACameraamera.001L>DB=B B@?LAgg(LASpot ?????AB>??8x}.?A4B?@@@ ???o:??????@?????DATA8x}'????C?55?55?py}??????DATApy}%??IPTy}P}IPObIpo@z}`{} dCF"@OBDATA\@z}z}{}?Bel@OB <DATA\z}`{}@z}}}?B @OB5cG@DATA\`{}z}}?BWK@\K@OB;z?DATA{}.w <? <| A <SA}A}@wA}ϭB;$B@1RBBg]?_TBl@tBl@НBl@wB26@B@ DBa]B ^B!@B;HBeBewBeDATA}}.y@?cG@ A?VUAs?A q=U7Ab B $B 7CB VBHSztB ?B2a@sB@B@4(B@gB@B@MB$'@B@BL@@BG@RBh{?B q=xBDATA}.};z??;z?Ӿ A;z?C< BVk<wB <B < B <DATAp}.#*I_??I_?#*AI_?Ao?LB? B?wB?B? B?WOlH}yWOWorld===??A <@pA A?L= ף;>}DATA }TXx8}ȳ}TXassetLoaderext.001}0}p}}}DATA}(}x}Nn+DATA(}p}}؝}P1y DATAp}}(}0}0hxDATA}}p}h}Nn(DATA}H}}Ȟ}|l2DATAH}}}0}8Kg:DATA}؎}H}}2iDATA؎} }}؟}@Gg8 DATA }h}؎}H}ȖjDATAh}} }}pxDATA}}h}Р}f DATA}@}}}HhDATA@}}}H}j'CurDATA}А}@}}P>x!!DATAА}}}}jDATA}`}А} }n"or(DATA`}}}x} w!orEDATA}}`}Т}o#DATA}8}}(}%iDATA8}}}`}<DATA}Ȓ}8}У} 6xDATAȒ}}}}wl#DATA}X}Ȓ}p}uhDATAX}}}}2xDATA}}X}}fDATA}0}}P}wFREEDATA0}x}}}4DATAx}}0}}`lDATA}}x}P}xl DATA}P}}}wDATAP}}}}lh2DATA}}P}`}qh FREEDATA}(}}}l,DATA(}p}}}DATAp}}(}8}PqhFREEDATA}}p}x}(1DATA}H}}}PtDATAH}}}}qhDATA}ؗ}H}X}wDATAؗ} }}}XifDATA }h}ؗ}}P DATAh}} } }ifDATA}}h}p}HfDATA}@}}}f)DATA@}}}}8h$:EEDATA}Й}@}`}phEEDATAЙ}}}}!EEDATA}`}Й}}DATA`}}}H}&DATA}}`}}DATA}8}}})DATA8}}}8}#DATA}ț}8}}1DATAț}}}}DATA}X}ț}0}!DATAX}}}}EDATA}}X}Ю}FREEDATA}0}}}DATA0}}@} DATA,x}# using python stuff, view all the files inDATA$؝}# the subDirectory "game_files" fDATA0}#DATA,h}# store a list of all of their locationsDATA4Ȟ}# from that list create a star chart on the screenrDATA<0}# each star being associated with that element in the listDATA}# aDATA<؟}# when the user clicks on that star, load that game file DATAH}DATA }# use actuator.fileName to set.DATA Р}import osDATA}mpoDATA(H}cont = GameLogic.getCurrentController()DATA}this = cont.ownerDATA}DATA$ }add = cont.getActuator("addAsset")DATA$x}kill = cont.getActuator("remove")DATA$Т}send = cont.getActuator("sendName")DATA(}__DATA@`}# load blend files that share directory with this game file.REEDATAУ}if this.start == 1:DATA$} allFiles = os.listdir(os.getcwd())DATAp} goodList = []EDATA } for i in range(len(allFiles)):DATA } temp = allFiles[i].split(".")DATAP} #print temp #flagDATA8} if temp[0] != "starChart": # shouldn't load itselfREEDATA} if temp[1] == "blend":DATA$P} goodList.append(allFiles[i])")DATA } if len(this.worlds) > 0:REEDATA4} this.worlds = this.worlds + "," + allFiles[i]DATA `} else:DATA0} this.worlds = this.worlds + allFiles[i]DATA} DATA8} this.start = 0DATA4x} print "these files should work:", goodList #flagDATA}rinDATA}# run the anim:DATAX}this.frame = this.frame + 1DATA}DATA}# load assets:EDATA }loaded = this.worlds.split(",")DATAp}DATA,}# add them at points along the animation:DATA(}if this.counter >= 30 - len(loaded):REEDATA`} this.counter = 0DATA$} if this.objCount != len(loaded):DATA} cont.activate(add)DATA(H} send.subject = loaded[this.objCount]EDATA } print loaded[this.objCount] EDATA} cont.activate(send)DATA$8} this.objCount = this.objCount + 1DATA4} # end everything when its all done adding stars:DATA} else:DATA$0} print "all stars now on screen"DATA} cont.activate(kill)DATAЮ} loDATA}else:EDATA$@} this.counter = this.counter + 1efTXxȳ}}8}TXcameraStuffext.001p}}}}}DATAp}}}FREEDATA}p}H}DATA}import RasterizerDATAH}Rasterizer.showMouse(1)TXx}ȳ}TXstarCodeh}}X}X}}DATAh}}P};DATA}}h}}FREEDATA}@}}}DATA@}}}@}'DATA}л}@}}FREEDATAл}}}}DATA}`}л}}$DATA`}}}p}"DATA}}`}}$DATA}8}} }#DATA8}}}x}DATA}Ƚ}8}}-DATAȽ}}}}) DATA}X}Ƚ}p}DATAX}}}}DATA}}X}}DATA}0}}8},DATA0}x}}}DATAx}}0}}s.fDATA}}x}0}1DATA}}}DATA<P}# this code is used for associating filenames to the properDATA}# loading system.DATA}b_qDATA(@}cont = GameLogic.getCurrentController()DATA}this = cont.getOwner()DATA}DATA(}message = cont.getSensor("needName")REEDATA$p}over = cont.getSensor("mouseOver")DATA(}click = cont.getSensor("mouseClick")EEDATA$ }load = cont.getActuator("loadGame")DATAx}istDATA0}if message.isPositive() and this.listen == 1:EEDATA,} this.fileName = message.getSubjects()[0]DATAp} this.listen = 0DATA} print "star created"DATA}DATA08}if over.isPositive() and click.isPositive():DATA} cont.activate(load) DATA } load.fileName = this.fileNameEDATA40} print "loading", load.fileName, "please wait..."DATA}qqqOBP}q}OBareaMastery} =???}}}} }`}}}????@???DATA@}}framerop}DATA@}`}}workpinrop}DATA@`}}}counterrop}DATA@}@}`}objCountrop}DATA@@}}}startropl}DATA@}@}worldsrop }DATA }DATAL}all the timeust onceenso}P}DATAP} }`}DATAh}workTRUEDATAP }`}assetLoader}}DATA }}}}DATAL}8}DATAP`} }cont1}DATA}}}DATA<}}  addAssetct}DATAP}}DATA<}}}  removeillctx}DATAPx}DATA<}}}sendNamecth}DATAlh}DATA<}}}playByFramesctx}DATATx}frameDATA<}}  addEffectctp}DATAPp}2}OBP}q}}OBCameraamera.001 P}w} I?{????b?'is;%V>kz?ȖT>is` >>b{?vQ>uA> I?{??????? >3d2?J2BA2? xW42??14t?!E3IC3aj1?@4'5?OBd????> P?u=???p}}P}`}}h} }}???DATA@p}}startrop}DATA@}p}timerrop }DATALP}}sensor}}DATA}}DATAh}startTRUEDATAL}`}P}run anim onceensor1(}DATA(}}DATAL`}}when anim endsensor2}}DATA}h}DATAh}timer3.44DATAP}}cont0}DATAL0}ȳ}DATAP}h}}cont10}DATA0} }DATAPh}}cont2}DATA}}DATA< }}camera animct}DATAT}eDATA<} }make start truect1}DATAL}startTRUEOBP}q(}}OBCubephereCz~}N?N?=N?N?=?????????ޕ/?4F:?81V~>85e?'?T2>ne@>M@?DOBd8?<?>Q8>u=???}}@}@}}}?@???gxyDATA}DATAL}sensorDATAP@}cont}DATA}}DATA<}acth}DATAh}physicsWorld.blendOBP(}q}}OBLamp gg]~<>@???{&?W+b=?6씾t? bfE9L"?%?_>oK?]~<>@??????3q3f1?h2e1?hЩ ,?5씾fE%?t?9L_> b"?oK? ?Af ?DOBd8?<?>Q8>u=???@???OBP}q(}(}OBparticlelaney~g@>B?)L"n>n>n>n>n>n>g@>B?)L"??????n??n3e/<@5?DOBd8? #=?>=???xxпhпh????@???(PyDATALsensorDATAxDATAPxcontwDATAwпhDATA<пhact[DATAl[=OBP(}q}}OBSpherekg<~BBBBBB?????????DOBd8? #=?>=???????@???`4iiyOBP}q(}OBworldSphereHy~zuB? L@ ??>?>?>?>?>?>zuB? L@ ??????? ̴B;t???@3OW4I?DOBd8? #=?>=???(}H}}P}}8~p~~????@???XI@yDATA@(}H}fileNamerop}DATA}hysicsWorld.blendDATA@H}(}listenropt}DATAL}}mouseOverensorp}8}DATA8}}8~DATAp}DATAL}}}mouseClickensor1`}(}DATA(}8~DATA`}DATAL}P}}all the timeensor}DATA}8~DATALP}} needNameensor1}}DATA}8~DATAD}DATAP}8~cont~DATA~p~DATAP8~}starCode~~DATA~~DATAL~}DATA<p~~act~DATAl~=<DATA<~p~loadGamect1~DATA~hysicsWorld.blend/MAl~*MAMaterial5L?L?L???????????L?????2?? ף; ף;? ?????????@?=?==???P~????L?L?L?L==ff????DATAP~!pMg??????????L>TEpMg&TETex>@???????@@????? @??<ME~4~MECubephere~P~Ԃu`~:xh:i {>l A4A4~{>{l A4~{{>l A4~{{l ˿~{{t{{>tI{>{tI{>{>tIIDATATh:i*uDATAu7$  " " """""" " "" " " " " " " "   """#"# " "##DATAT~߽H>хb?~A߽˅bJ>~QA߽Gʅb~Q bqE? ?}[ b ?rE㿐}[IbrE }Ib sE?}be>9?n @b9e>n be9쿀n; b9?en @;b>{IIv b>{I?Iv{&b>{I??Iv{&)b>?{IIv)DATATy*hvDATAhv7$"#""""#"""#" " " " " " " " " " " " """""""""""""DATAT8z*VTex豃UVTexHx@ColH wDATA豃6      DATAHxA ????????????????????????????????????????????????DATAH w;0ME~4<~~MESphereB-~~"~5~~p!~ ,~$\d???DATAT~*~DATA~:\z7>qxs?v'yy?O?KgO?y?vgZKqxs?y7>y'?.;pxs?{7y]O?yvgy?OK]s7>rxsv'>sM>9>rxs1>ox>C>O<&,]ߍ'?rx>yS<D??|7ubG]O?y?g;KD??x7>ubG'ߍ'?rx>y?SD>O?<&,g>9>qxs?1y =y>qxs?1 %y9>?O?5oGg>D?y?fbZKy>g?x7>%s'x7>rxs?'yy>ߍg?|7%s]>D?yfb9>?O5oG]=y>rxs1 %> ýy>rxs%>9?OoG]D?yfbyߍg?|7eڿs]~7rxs?sػyyg?x7>eڿs'D?y?fbZK9?O?oGgýy>qxs?%y9>qxs?1yuxC>O?<&,g'qx>y?LG'Oy?s;KD?|7G]'qx>yL<sxB>O<&,]9>rxs1>u7Tirxs>yhóO]Owysxs)5|7L]¡$txs&x7>L'Owy?ZKy~ڳO?g{7wqxs?y9qxs?yrxI䰾O?<ӣg'zxy?L0ZKDx7>w'OysŴD|7w]'zxyL0æpxH䰾O<]9rxs>ýyrxsy>9O葸]Dyyg|7eA]w7wxssEygx7>eA'Dy?ZK9O?葸gýyqxs?yy?=yqxs?1 yy9>O?5g >Dy?ZK$y>gx7>%A'7>uxs'E"y>g|7%A] >Dy9>O5]=yrxs1 y>>9rxs>xx>A䰾O<]'?pxyS0æD?|7ubw]O?ygŴD?x7>ubw''?pxy?S0ZKzx>B䰾O?<ӣg>9qxs?yDATATp!~*"~DATA"~7######## # # # # # # # ## ################### ## ## ## ######## # #!# !#"#!"###"##$##$#$%#%&##&#&'#"'#'(#!(#()# )#)*#*#*+#+#+,#,#,-#-#-.#,/#./#+0#/0#*1#01#)2#12#(3#23#'4#34#&5#45#%6#56#67#78#58#89#49#9:#3:#:;#2;#;<#1<#<=#0=#=>#/>#>?#.?#?@#>A#@A#=B#AB#<C#BC#;D#CD#:E#DE#9F#EF#8G#FG#7H#GH#HI#HJ#JK#GK#KL#FL#LM#EM#MN#DN#NO#CO#OP#BP#PQ#AQ#QR#@R#RS#QT#ST#PU#TU#OV#UV#NW#VW#MX#WX#LY#XY#KZ#YZ#J[#Z[# #S#T#U#V#W#X#Y#Z#[#I#I[# S# R#IJ# @# ?#7I#6I# .# -#%I#$I# # #I#I#DATAT,~*-~Col5~DATA-~6d     II            !!""##$$I$%I#&%$"'&#!('" )(!*) +*,+-, - .--./,,/0++01**12))23((34''45&&56%%6I67I587649853:942;:31<;20=<1/>=0.?>/ ?. @??@A>>AB==BC<<CD;;DE::EF99FG88GH77HIHJIGKJHFLKGEMLFDNMECONDBPOCAQPB@RQA R@ SRRSTQQTUPPUVOOVWNNWXMMXYLLYZKKZ[JJ[I[I[ZYZXYWXVWUVTUST SDATA@5~;ME<~4~MESphere.001.xps`E@M|`gh3f (P???DATAT`g*`EDATA0]`E:d=ץ={!}ő>g=t|z6+>%=dlr@v>X=a;p7~ ?=8TB!ljH?w=E])b1?B >5g"3Q%P?&>9=Go]?.0>ZJV<g?ѐ8> þ0Ep?+?><߇'%Av?C>Gᄃ;y?F>PȽ' {?G>w;y?F>(='uAv?C>G>ᄃEp?+?>0>߇g?Ґ8>>o]?/0>Z>J(P?&>9?=B?m>g"?ͮ1?B >5?X=a?;K+>6=^l?rő>g= t?C> ={?!w='5={?rwO>= t?>>^l?B>8>a?BQf?ʵY>1T?N䔕 ?+x>E?t='?ԋ>5?c^~6?u>g"?$ͮKD?>9?FP?\̬>Z>ԪxZ?>>7Tb?@>0>׎!g?J+>G>_k?>(=RAu]l?>_k?>PȽRAϋ g?J+>G6Tb?>><׎!'%vZ?> þ0P?Z̬>Z񾶗V<HD?>9FG6?|u>g"$3Qn='?ϋ>5c^݂Z ?!x>EbIf?Y>8TNlj>8>aBp> >dlB@vO>=t|z8>={r}u=K=n~i3a<=0 _=n~a&>w={=!}'w>$%>t\|z>Y>dlG@v>>a{pP>l>8Tlj?Lt>E}b?F#>5͂Z>$?_>g"3Q0?Z>9G;?:>Z%JV<HD?Of? þN0ϰK? ?<)'%'P?>~ ?GBS? ?PȽ< /T?9?S? ?(=~ ?G>BаK??0>)JD?Pf?>N;?=>Z>%J0?]>9?B$?d>g"?ͮ?N#>5?~?Tt>E?}^>v>1T?ؔ>>a?{>ɵY>^l?G'w>$%> t?\넅&>={?=!w= _=m~?==m~?""B >B >{?XXwD0R>D0R> t?儅Ӌ>Ӌ>^l?^^>>a?WWM#>N#>1T?͸͔Ĭ>Ŭ>E?Ɩ>>5?~ ? ?g"? ͮ??9???Z>//r='?s='?>cb9-?9-?0>dd1?1?G><<%4?%4?(=u5?5?%4?%4?PȽ 1?1?G<<9-?9-?>5Z>>EƖbA#>B#>8T͸lj䩪>婪>aWWpċ>ŋ>dl^^@v%0R>&0R>t|zB >B >{XX}`=`=n~""a[[/ _=;=n~av=&>{!=}$%>'w>t\|zY>>dlG@v>>a{pk>P>8TljJt>?E}bD#>?5Z[>>$?g"ɼ3QV>0?9ăG9>;?ZJ%V<Mf?HD? þN0 ?ϰK?<)'%<~ ?'P?GB ?S?PȽ< 9?/T?且 ?S?(=<u=~ ?'P?G>B ?ѰK?0>)Nf?JD?>N;>;?Z>J%\>0?9?ăb>C$?g"?ɼͮL#>?5?~Rt>?E?}t>^>1T?Ĕ>>a?{ǵY>>^l?G$%>'w> t?\ᄅ=&>{?!=w _==m~?=ou=m~?3i1=ѐ8>{?rw=O> t?݄>>^l?B8>>a?BƵY>Pf?1T?N'x> ?E?ҋ>t='?5?^c~|u>6?g"?$ژͮ>ID?9?F׮Y̬>P?Z>Զ>wZ?><>7Tb?0>!׎G+>g?G>>_k?(=BRu>[l?>_k?PȽBR E+>g?G;>4Tb?tZ? þ0X̬>P?ZԶV<>GD?9F׮Gwu>6?g"$ژ3Q̋>m='?5^cZx> ?EbY>If?8TNlj8>>aBp>>dlB@v=O>t|z=8>{r}J=u=n~3iaե{!}g=ő>t|z=4+>dlr@v X=>a;p=6~ ?8T!Bljw=H?E)]bB >}1?5XB?g"3Q&>#P?9=럗G.0>o]?ZJV<ʐ8>g? þ0+?>Dp?<߇'% C>Av?G}F>9y?PȽ' G>{?w}F>9y?(='uC>Av?G>+?>Ep?0>߇ʐ8>g?>.0>o]?Z>J&>%P?9?=럗m>B?g"?ͮB >1?5?X<~w=H?E?)]=>~ ?1T?!BX=>a?;0=H+>^l?rg=ő> t?ۄ=C>{?!w!<=m~?23=m~?uMG>{?w t?ڄ<'ز>^l?)9NZ>a?#9?1T?且t7g"?E?ήt5?5?~E?g"?ͮ01-T?9?.ta?Z>mZl?>t?0>D{?G>w`j~?(=uW(?`j~?PȽ Ƴ{?Gw ?]t?<'%eWl? þ0Oa?ZV<+T?9GE?g"3QQ2]5?5Z3g"?Eήb#,9?8Tlj3Z>ap->dl@vࢲ>t|zxG>{}.~°ͼ=n~ua֥a=n~raC>{}gő>t?|z(昽3+>dl @vX>a pݽ5~ ?8T BljwH?E]bB |1?5}+?Dp?0>߇Ր8g?>/0o]?Z>J&$P?9? mB?g"?MͮB 1?5?<~wH?E?]ݽ=~ ?1T? BX>a? 6昽G+>^l? gő> t??ۄC>{?w)=m~?rmu=m~?i5昽ϐ8>{? wO> t?7݄>^l?8>a?BɵYOf?1T?6N+x ?E?Ջs='?5?"c~u6?g"?%ͮ颾GD?9?([̬P?Z>2+tZ?>@-@4Tb?0>.׎I+g?G> 0¾_k?(=0RuþYl?0¾_k?PȽ0R I+g?G 0=2Tb?<.׎'%rZ? þ@-0Z̬P?Z2+V<颾ED?9(G|u6?g"%3Q΋k='?5"cZx ?EbYGf?8T6Nlj8>aBp >dl@vO>t7|z昽8>{ }Ju=n~ia- _9=n~auݽ&>{ =}$%'w>t|zY>dl6G@vޭ>a!pkL>8T'ljJt?E-}bD#ɾ?5H2Z^۾:$?g"63QY쾾0?9 ;G9;?Z>%V<MfED? þA0 ̰K?< D)'%=~ "P?GE S?PȽF 9,T?G S?(=Fu=~ $P?G>E ͰK?0> D)OfFD?>A;;?Z>>%X0?9? ;b۾?$?g"?6ͮN#ɾ?5?H2~St?E?-}tZ>1T?'Ĕ>a?!ǵY>^l?6G$%'w> t?ᄅݽ&>{? =w _=m~?񍽥=m~?"B B >{?XwB0RB0R> t?E儅ҋЋ>^l?"^頻>a?*WL#ɾI#>1T?H2͔Ĭ>E?j9>5??~  ?g"?E ͮ?9?@K?Z>O/q='n='?>Sc9-9-?0>Vd11?G>X<%4%4?(=Zu55?Z%4%4?PȽZ 11?GX<9-9-?5?Z徵>Ej9b@#ɾ=#>8TH2lj㩪ᩪ>a*Wpċ‹>dl"^@v#0R!0R>tE|zB B >{X}^]=n~"a9覽* _=n~n a&r={!}'w$%>t\|z颾Y>dl(@vޭȾ>a*2{pMg>8T ;ljFt>ECb@#>5@K͂Z<$T>g"DR3Q0Q>9}XG;4>Z]JV<EDKf? þRbN0̰K ?ahBΰK ?0>eGDKf?>RbN;7>Z>]J0W>9?}X@$\>g"?DRͮJ#>5?@K~Ot>E?C[p>1T? ;ؔȾ>a?*2{颾µY>^l?('w$%> t?\넅&={?!w覽 _=m~?n ?lu=m~? 3ϐ8/={?rwO= t?S">^l?@-B޾8>a?7NfY>1T?A䔕 "x>E?Kr='Ћ>5?S^~6xu>g"?h[$ͮFD>9?RbFPV̬>Z>JhԪsZ>>@m3Tb7>0>)q!gD+>G>s_k>(=uAuXl >@v_k>PȽuBϋ g@+>Gs1Tb8><)q!'%qZ> þ@m0PT̬>ZJhV<DD>9RbFG6qu>g"h[$3Qk='ɋ>5S^݂Z x>EKbGfY>8TAlj޾8>a7p>dl@-B@vO}=tS"|z8 ={r}uF=n~ 3a_Ľϥ5XXZBm>g" a3QP&>9ah=Go].0>ZnV<gǐ8> þs0Dp+?>G{6yuF>PȽ|' {G>}6yuF>(=|'uAv C>G>{Dp+?>0>!xgÐ8>>so].0>Z>n"P&>9?ah=Bm>g"? aͮ1B >5?XX~Hw=E?O);~ =1T?E!X=a?-;;E++=^l? 0rőg= t?p$C={?}!wĽ^l?0Za?U<9ڊ1T?Gg"KE?2Q5[5?Z~Eg"?bͮ*Tv9?ljaZ>pVlr>@vty0>|z{j&9G>}f~(=auɳf~PȽa {+G}t#݁<{z'%Tl þ@v0aZpV<&TЎ9ljGEMg"b3Q5ٳ5ZZg"ijE2Qb9_ 8TGljZ=:aU<pþdl0@v0\ɲt'%|zG~{}ʼȽ, n~ a^Ľץn~M raC{}}őgtp$?|z2+*昽dl 0 @vXa-; p3~ ݽ8TE ljHwEObz1B 5XZB!mg" aM3QP&9ahGn]/0ZnV<gϐ8 þs0Dp+?{}Dp+?0>!xg֐8>so]/0Z>n!P&9?ahB mg"? aMͮ1B 5?X~HwE?O:~ ݽ1T?E Xa?-; D+6昽^l? 0 őg t?p$?C{?}wĽ(m~?M rjum~? ͐84昽{? wO t?S"7^l?@-޾8a?7LfǵY1T?A6 *xE?Kp='ҋ5?S"~6~ug"?h[%ͮDD颾9?Rb(PZ̬Z>Jh2+pZ>@m@-/Tb>0>)q.gE+G>s 0_k¾(=u0uVlþ@v0_k¾PȽu0 gH+Gs 0/Tb;<)q.'%oZ þ@m@-0PZ̬ZJh2+V<@D颾9Rb(G6|ug"h[%3Qi='΋5S"Z xEKbEfY8TA6lj޾8a7p dl@-@vOtS"7|z8 昽{ } uIn~ a6覽+ _n~n a&rݽ{ }'w$%t|z颾Ydl(6@vڭȾa*2!pHk8T ;'ljItEC-b D#ɾ5@KH2Z6$\۾g"DR63Q0T9}X ;G;8Z]>V<BDLf þRbA0ɰK ahEɰK 0>e DCDNf>RbA;9Z>]>0V9?}X ;<$`۾g"?DR6ͮJ#ɾ5?@KH2~QtE?C-Ur1T? ;'Ⱦa?*2!颾ŵY^l?(6'w$% t?&ݽ{? w覽 _m~?n 񍽥m~?B B {?w>0RA0R t?EE΋Ћ^l?""쩪a?**E#ɾI#ɾ1T?H2H2E?j9j95???~  g"?EEͮ9?@K@K Z>OOl='p='>SS~9-9-0>VV}11G>XX%4%4(=ZZu55ZZ%4%4PȽZZ |11GXX~9-9-]V<HfDD þARb0ʰK< De'%6~ "PGEah SPȽFi 9*TGlj S(=Fiu7~ PG>Eah˰K0> DeIfFD>ARb2;Z>>]R쾽09? ;}XW۾=$g"?6DRͮF#ɾ5?H2@K~JtE?-CmW1T?' ;Ⱦa?!*2Y颾^l?6($%'w t?ݽ&{? w _覽m~?n jum~? +昽͐8{? wO t?7S"^l?@-8޾a?7YLf1T?6Ax E?K͋o='5?"S~tu6g"?%h[ͮ颾BD9?(RbR̬PZ>2+JhrZ>@-@m40Tb0>.)q>+gG> 0s¾_k(=0uuþUl0@v¾_kPȽ0u ;+gG 0s5/Tb<.)q'%pZ þ@-@m0P̬PZ2+JhV<颾AD9(RbGmu6g"%h[3Qŋi='5"SZx EKbYEf8T6Alj8޾a7pdl@-@vyOt7S"|z昽8{ }C un~ a˥]Ľn~rM aC{}}zgđt?p$|z昽1+dl 0@vX쾜a -;pݽ2~ 8T EljwHEObB x15XZmBg"M a3Q&P9ahG.0n]ZnV<8g þs0+?Dp<!x'%CAvG}{qF0yPȽ| G{}qF0y(=|uCAvG>}{+?Dp0>!x8g>s.0o]Z>n&P9?ah mBg"?M aͮB 15?X~wHE?Oݽ9~ 1T? EX쾗a? -;(昽C+^l? 0gő t??p$C{?}wĽm~?rM ~2-Ƚm~? m3G{?w3+ t?'%Lj3 þ^l?0>2Za?U<^391T?GT 4g"E?2Q355?Z~ 4Eg"?bͮz3&T9?lj~74aZ>p\4Tl>@vHK"4t0>|zZ3{G>}3`~(=au 43`~PȽa 4{G}3t<|z'%qc4Rl þ@v0M4aZpV<24#T9ljG^4Eg"b3Q }%455ZZ4g"E2Qb398TGljl3ZaU2t'%|z/3G{}NU2ȼȽn~ aץ<\Ľn~M a=C{!}}g=đtp$|z,=/+dlr 0@vX=쾜a;-;p=1~ 8T!Eljw=HE)ObB >w15XXZ#m>Bg" a3Q&>P9=ahG/0>n]ZnV<א8>g þs0+?>Dp<!x'%C>AvG{zF>.yPȽ'| G>{}zF>.y(='|uC>AvG>{+?>Dp0>!xؐ8>g>s/0>n]Z>n&>P9?=ahm>Bg"? aͮB >~15?XX~x=HE?)O=8~ 1T?!EX=쾗a?;-;6=A+^l?r 0g=ő t?p$= C{?!}w+<Ľm~?M =fum~?3 3=ʐ8{?rw=O t?S">^l?B@-8>޾a?7ĵY>Jf1T?A)x> E?KЋ>m='5?^ݝS~{u>6g"?#h[ͮ>@D9?FRb[̬>PZ>Jh>mZ>@m<>-Tb0>!)qC+>gG>s>_k(=AϮuu>Ql@v>_kPȽAϮu I+>gGs:>,TblZ þ@m0Z̬>PZJhV<>=D9FRbG|u>6g"$h[3Q΋>f='5^ݝSZx> EKbY>Cf8TAlj8>޾a7p >dlB@-@v|=OtS"|z=8{r}H= un~3 a* _=4覽n~n ar=&{!}$%>'wt\|zY>颾dl(@v>حȾa{*2pi>D8T ;ljGt>E҃CbB#> 5@KZ[>4$g"DR3QS>09}XG7>;ZJ]V<Mf??D þNRb0 ?ưKBah ?ǰK0>eMf?@D>NRb9>;Z>J]S>09?}X[>7$g"?DRͮG#>5?@K~Pt>E?҃Cp>Q1T? ;>Ⱦa?{*2µY>颾^l?($%>'w t?\=&{?!w _=覽m~?n =m~?"B >B {?Xw=0R>:0R t?E΋>̋^l?^ݢ"멪>驪a?Wթ*F#>A#ɾ1T?H2>E?j9>5??~ ? g"? Eͮ? 9?@K ? Z>/On='?i='>bS9-?|9-0>dV|1?y1G>5?Z>Ej9b<#>6#ɾ8TH2ljߩ>ܩaWթ*p‹>dl^ݢ"@v0R>0RtE|zB >B {X}\=Yn~"a6=# _n~a&>iݽ{= }'w>$%t|z>YdlG6@vڭ>aͅ!pH>a8Tā'lj?>tE}-b ?7#ɾ5H2Z8$?K۾g"63Q0?G9 ;G;?+Z%>V<CD?Ff þA0ȰK?<) D'%!P?3~ GES?} PȽF 'T?9GS?} (=FuP?4~ G>EʰK?0>) DCD?Ff>A;?.Z>%>0?M9? ;:$?Q۾g"?6ͮ?B#ɾ5?H2~?GtE?}-T>j1T?ā'>a?ͅ!>Y^l?G6'w>$% t?&>ݽ{?= w= _m~?hu=m~?iː8>(昽{? wO> t?7>^l?Ҿ>8a?BJf?Y1T?N6 ?xE?m='?ʋ5?c"~6?oug"?%ͮ@D?颾9?(P?O̬Z>2+nZ?>@-.Tb?10>׎.g?9+G> 0_k?~¾(=R0uRl?þ0_k?~¾PȽR0 g?5+G 0,Tb?0<׎.'%nZ? þ@-0P?L̬Z񾶗2+V<>D?颾9(G6?jug"%3Qg='?5c"Z ? xEbDf?Y8TN6lj>8aBp>dlҾ@vO>rt7|z8>昽{ } u=@n~ia[=ƥn~raC>{}đ>qgt?|z/+>昽dlώ @v>Wa p0~ ?ݽ8TB ljH?wE]bv1?B 5<ZB?lg"M3QP?&9Gn]?.0ZJV<g?8 þ0Dp?+?<߇'%Av?CG},y?jFPȽ {?Gw,y?jF(=uAv?CG>}Dp?+?0>߇g?8>n]?.0Z>JP?&9?B?mg"?Mͮ}1?B 5?<~H?wE?]7~ ?ݽ1T?B > Xa? @+>'昽^l?ώ ő>g t?? C>{?w=m~?r+=/3m~?uG>0AP3{?w)>-3 t? >2>3^l?Z>d;q3a?9?Ol?4>t?LK40>{?84G>w\~?+ 4(=u?x4\~?+ 4PȽ {?4Gwt?S24<'%Ol?4 þ0a?.C4ZV< T?[49GE?Ǐ4g"3Q5?j45Zg"?4Eήb9?F$48TljZ>FO3ap>3dl@v>3t|zG>J-3{}Ƽ=$2n~uaDATATh3f*DATA^7!####### # # # # # ################!# ! # !#!#!"#"#"#####$#$#$%#%#%&#&#&'#'#'(#(#()#)#)*#*#*+#+#+,#,#,-#-#-.#.#./#/#/0# 0#01# 1#12# 2#23# 3#34# 4#45#5#56#6#67#7#78#8#89#9#9:#:#:;#;#;<#<#<=!=#=>#<?#>?!;@#?@#:A#@A#9B#AB#8C#BC#7D#CD#6E#DE#5F#EF#4G#FG#3H#GH#2I#HI#1J#IJ#0K#JK#/L#KL#.M#LM#-N#MN#,O#NO#+P#OP#*Q#PQ#)R#QR#(S#RS#'T#ST#&U#TU#%V#UV#$W#VW##X#WX#"Y#XY#!Z#YZ# [#Z[#\#[\!\]#]^![^#^_#Z_#_`#Y`#`a#Xa#ab#Wb#bc#Vc#cd#Ud#de#Te#ef#Sf#fg#Rg#gh#Qh#hi#Pi#ij#Oj#jk#Nk#kl#Ml#lm#Lm#mn#Kn#no#Jo#op#Ip#pq#Hq#qr#Gr#rs#Fs#st#Et#tu#Du#uv#Cv#vw#Bw#wx#Ax#xy#@y#yz#?z#z{!>{#{|!{}#z~#}~!y#~#x##w##v##u##t##s##r##q##p##o##n##m##l##k##j##i##h##g##f##e##d##c##b##a##`##_##^##]#!#!########################################################~#!}###!#########################################################!#!#########################################################!###!############################ # # #  # #  # #  # #  ## ##################!#!############# # # !#!#!"# "#"## ###$# $#$%# %#%&# &#&'#'#'(#(#()#)#)*#*#*+#+#+,#,#,-#-#-.#.#./#/#/0#0#01#1#12#2#23#3#34#4#45#5#56!6#67#58#78!49#89#3:#9:#2;#:;#1<#;<#0=#<=#/>#=>#.?#>?#-@#?@#,A#@A#+B#AB#*C#BC#)D#CD#(E#DE#'F#EF#&G#FG#%H#GH#$I#HI##J#IJ#"K#JK#!L#KL# M#LM#N#MN#O#NO#P#OP#Q#PQ#R#QR#S#RS#T#ST#U#TU!UV#VW!TW#WX#SX#XY#RY#YZ#QZ#Z[#P[#[\#O\#\]#N]#]^#M^#^_#L_#_`#K`#`a#Ja#ab#Ib#bc#Hc#cd#Gd#de#Fe#ef#Ef#fg#Dg#gh#Ch#hi#Bi#ij#Aj#jk#@k#kl#?l#lm#>m#mn#=n#no#<o#op#;p#pq#:q#qr#9r#rs#8s#st!7t#tu#sv#uv!rw#vw#qx#wx#py#xy#oz#yz#n{#z{#m|#{|#l}#|}#k~#}~#j#~#i##h##g##f##e##d##c##b##a##`##_##^##]##\##[##Z##Y##X##W##V#!!#!########################################~##}##|##{##z##y##x##w##v#!u###!#########################################################!#!#########################################################!###!########################################## # # #  # #  # #  # #  ## ####!#!#### ## ## ## ## ############### # # !#!#!"#"#"#####$#$#$%#%#%&#&#&'#'#'(#(#()#)#)*#*#*+#+#+,#,#,-#-#-.#.#./!/#/0#.1#01!-2#12#,3#23#+4#34#*5#45#)6#56#(7#67#'8#78#&9#89#%:#9:#$;#:;##<#;<#"=#<=#!>#=># ?#>?#@#?@#A#@A#B#AB#C#BC#D#CD#E#DE#F#EF#G#FG#H#GH#I#HI#J#IJ#K#JK#L#KL#M#LM#N#MN!NO#OP!MP#PQ#LQ#QR#KR#RS#JS#ST#IT#TU#HU#UV#GV#VW#FW#WX#EX#XY#DY#YZ#CZ#Z[#B[#[\#A\#\]#@]#]^#?^#^_#>_#_`#=`#`a#<a#ab#;b#bc#:c#cd#9d#de#8e#ef#7f#fg#6g#gh#5h#hi#4i#ij#3j#jk#2k#kl#1l#lm!0m#mn#lo#no!kp#op#jq#pq#ir#qr#hs#rs#gt#st#fu#tu#ev#uv#dw#vw#cx#wx#by#xy#az#yz#`{#z{#_|#{|#^}#|}#]~#}~#\#~#[##Z##Y##X##W##V##U##T##S##R##Q##P##O#!#!##########################~##}##|##{##z##y##x##w##v##u##t##s##r##q##p##o#!n###!#########################################################!#!#########################################################!###!#########################################################! #  ! #  # #  # #  # # #################################### # # !#!#!"#"#"#####$#$#$%#%#%&#&#&'!'#'(#&)#()!%*#)*#$+#*+##,#+,#"-#,-#!.#-.# /#./#0#/0#1#01#2#12#3#23#4#34#5#45#6#56#7#67#8#78#9#89#:#9:#;#:;#<#;<#=#<=#>#=>#?#>?#@#?@#A#@A# B#AB# C#BC# D#CD# E#DE# F#EF!FG#GH!EH#HI#DI#IJ#CJ#JK#BK#KL#AL#LM#@M#MN#?N#NO#>O#OP#=P#PQ#<Q#QR#;R#RS#:S#ST#9T#TU#8U#UV#7V#VW#6W#WX#5X#XY#4Y#YZ#3Z#Z[#2[#[\#1\#\]#0]#]^#/^#^_#._#_`#-`#`a#,a#ab#+b#bc#*c#cd#)d#de!(e#ef#dg#fg!ch#gh#bi#hi#aj#ij#`k#jk#_l#kl#^m#lm#]n#mn#\o#no#[p#op#Zq#pq#Yr#qr#Xs#rs#Wt#st#Vu#tu#Uv#uv#Tw#vw#Sx#wx#Ry#xy#Qz#yz#P{#z{#O|#{|#N}#|}#M~#}~#L#~#K##J##I##H##G#!#!##########~##}##|##{##z##y##x##w##v##u##t##s##r##q##p##o##n##m##l##k##j##i##h##g#!f###!#########################################################!#!#########################################################!#|!!!|!|!!!|f!|e!G!F!|(!|'! !!|!|!!!|!|!!!|n!|m!O!N!|0!|/!!!|!|!!!|!|!!|u!|t!V!U!|7!|6!!!|!|!!!|!|!!!|}!]!\!>|!=|!!!################# # # # # #########|!#DATAT(*VTexpUVTexs@Col@M|DATAPp6|        !!""##$$%%&&''(())**++,,--../ /0 01 12 23 34 45566778899::;;<<=|=|=>=<?><;@?;:A@:9BA98CB87DC76ED65FE54GF43HG32IH21JI10KJ0/LK/.ML.-NM-,ON,+PO+*QP*)RQ)(SR('TS'&UT&%VU%$WV$#XW#"YX"!ZY! [Z \[\\][\]^Z[^_YZ_`XY`aWXabVWbcUVcdTUdeSTefRSfgQRghPQhiOPijNOjkMNklLMlmKLmnJKnoIJopHIpqGHqrFGrsEFstDEtuCDuvBCvwABwx@Axy?@yz>?z{|>{|{}{z~}zy~yxxwwvvuuttssrrqqppoonnmmllkkjjiihhggffeeddccbbaa``__^^]]~}~|}|||            ! !"  "#  #$  $%  %& &''(())**++,,--..//0011223344556|6|676587549843:932;:21<;10=<0/>=/.?>.-@?-,A@,+BA+*CB*)DC)(ED('FE'&GF&%HG%$IH$#JI#"KJ"!LK! ML NMONPOQPRQSRTSUTUUVTUVWSTWXRSXYQRYZPQZ[OP[\NO\]MN]^LM^_KL_`JK`aIJabHIbcGHcdFGdeEFefDEfgCDghBChiABij@Ajk?@kl>?lm=>mn<=no;<op:;pq9:qr89rs78st|7t|tutsvusrwvrqxwqpyxpozyon{znm|{ml}|lk~}kj~jiihhggffeeddccbbaa``__^^]]\\[[ZZYYXXWWVV~}~|}{|z{yzxywxvwuv|u|||                      !!""##$$%%&&''(())**++,,--../|/|/0/.10.-21-,32,+43+*54*)65)(76('87'&98&%:9%$;:$#<;#"=<"!>=! ?> @?A@BACBDCEDFEGFHGIHJIKJLKMLNMNNOMNOPLMPQKLQRJKRSIJSTHITUGHUVFGVWEFWXDEXYCDYZBCZ[AB[\@A\]?@]^>?^_=>_`<=`a;<ab:;bc9:cd89de78ef67fg56gh45hi34ij23jk12kl01lm|0m|mnmlonlkpokjqpjirqihsrhgtsgfutfevuedwvdcxwcbyxbazya`{z`_|{_^}|^]~}]\~\[[ZZYYXXWWVVUUTTSSRRQQPPOO~}~|}{|z{yzxywxvwuvtustrsqrpqopno|n|||            !!""##$$%%&&'|'|'('&)(&%*)%$+*$#,+#"-,"!.-! /. 0/102132435465768798:9;:<;=<>=?>@?A@ BA  CB  DC  ED  FE FFGEFGHDEHICDIJBCJKABKL@ALM?@MN>?NO=>OP<=PQ;<QR:;RS9:ST89TU78UV67VW56WX45XY34YZ23Z[12[\01\]/0]^./^_-._`,-`a+,ab*+bc)*cd()de|(e|efedgfdchgcbihbajia`kj`_lk_^ml^]nm]\on\[po[ZqpZYrqYXsrXWtsWVutVUvuUTwvTSxwSRyxRQzyQP{zPO|{ON}|NM~}ML~LKKJJIIHHGG~}~|}{|z{yzxywxvwuvtustrsqrpqopnomnlmkljkijhighfg|f||DATAsA|??|???>?8j<b&x?(?|??|??x??8j<x??t??7t??b&x?(?8j<t??p??Gp??7t??8j<p??l??Sl?,?Gp??8j<l??h??#]h?x?Sl?,?8j<h??d?? cd?r ?#]h?x?8j<d??`??/e`?F ? cd?r ?8j<`??\??mc\?U ?/e`?F ?8j<\??X??]X?F ?mc\?U ?8j<X??T??TT?!?]X?F ?8j<T??P?? HP??TT?!?8j<P??L??8L?yM? HP??8j<L??H??'H?L?8L?yM?8j<H??D??D??'H?L?8j<D??@??@??D??8j<@??;?i?8j<@??;??>;?i?@? ?8j<D??@??@? ?SD?i?8j<'H?L?D??SD?i?H?=Z?8j<8L?yM?'H?L?H?=Z? L?E?8j< HP??8L?yM? L?E?#,Q?dr?8j<TT?!? HP??#,Q?dr?^U?q ?8j<]X?F ?TT?!?^U?q ?Y?c?8j<mc\?U ?]X?F ?Y?c?]?x?8j</e`?F ?mc\?U ?]?x?{a?$T?8j< cd?r ?/e`?F ?{a?$T?we??8j<#]h?x? cd?r ?we??owi?Cu?8j<Sl?,?#]h?x?owi?Cu?Om??8j<Gp??Sl?,?Om??q? ?8j<7t??Gp??q? ?t?& ?8j<b&x?(?7t??t?& ?[x??8j<|??b&x?(?[x??M|??8j<?>|??M|???8j<?>M|??|?p??8j<M|??[x??hRy?w?|?p?8j<[x??t?& ?u? 3 ?hRy?w?8j<t?& ?q? ?n|r?Bu?u? 3 ?8j<q? ?Om??n?×?n|r?Bu?8j<Om??owi?Cu?Vk??n?×?8j<owi?Cu?we??Xg?Y?Vk??8j<we??{a?$T?c? ?Xg?Y?8j<{a?$T?]?x?_?,$?c? ?8j<]?x?Y?c?[? '?_?,$?8j<Y?c?^U?q ?:GW?ֹ)?[? '?8j<^U?q ?#,Q?dr?R?+?:GW?ֹ)?8j<#,Q?dr? L?E?@N?b-?R?+?8j< L?E?H?=Z?;I?M.?@N?b-?8j<H?=Z?SD?i?D?/?;I?M.?8j<SD?i?@? ?@?0?D?/?8j<@? ?>;?i?52;?/?@?0?8j<>;?i?\7?=Z?n6?M.?52;?/?8j<\7?=Z?3?F?-1?c-?n6?M.?8j<3?F?.?dr?B+-?+?-1?c-?8j<.?dr?H*?q ?Ǹ(?׹)?B+-?+?8j<H*?q ? }&?c?Dk$? '?Ǹ(?׹)?8j< }&?c?Lh"?x? D ?,$?Dk$? '?8j<Lh"?x?c?$T?B? ? D ?,$?8j<c?$T?n??e?Y?B? ?8j<n???Du?Y??e?Y?8j<?Du?\?? ?ŗ?Y??8j<\??2? ? ?Du? ?ŗ?8j<2? ?" ?' ?  ? 3 ? ?Du?8j<" ?' ?g???x?  ? 3 ?8j<g????ET?p??x?8j<????ET?p??8j<ET?p???>???8j<?x?ET?p?>???F ?8j<  ? 3 ??x??F ???8j< ?Du?  ? 3 ???ޛ ?$T?8j< ?ŗ? ?Du?ޛ ?$T??!?8j<Y?? ?ŗ??!?? ?8j<e?Y?Y??? ?pl?%?8j<B? ?e?Y?pl?%??*?8j< D ?,$?B? ??*??/?8j<Dk$? '? D ?,$??/?('!?"73?8j<Ǹ(?׹)?Dk$? '?('!?"73?%?6?8j<B+-?+?Ǹ(?׹)?%?6?h*?:?8j<-1?c-?B+-?+?h*?:?}/? ?8j<52;?/?n6?M.?4?r>?w\:?ʛ??8j<@?0?52;?/?w\:?ʛ??@?@?8j<D?/?@?0?@?@?E?ʛ??8j<;I?M.?D?/?E?ʛ??3,K?r>?8j<@N?b-?;I?M.?3,K?r>?P? |?p?*}???8j<?>*}??}???8j<*}??Nz?F ?{?F ?}??8j<Nz?F ?dw??2y?7?{?F ?8j<dw??$dt?"T?v?c?2y?7?8j<$dt?"T?Fq? ?!=t? ?v?c?8j<Fq? ?1n? ?q? '?!=t? ?8j<1n? ?j?%?n?F-?q? '?8j<j?%?Rf?*?Vk? 73?n?F-?8j<Rf?*?c?/?g?8?Vk? 73?8j<c?/?^?!73?c?3>?g?8?8j<^?!73?S_Z?6?6_?C?c?3>?8j<S_Z?6?U?:?LZ?aG?6_?C?8j<U?:?P? ?N?jM?\T?#J?8j<3,K?r>?E?ʛ??&G?wjO?N?jM?8j<E?ʛ??@?@?@?O?&G?wjO?8j<@?@?w\:?ʛ??8?wjO?@?O?8j<w\:?ʛ??4?r>?1?jM?8?wjO?8j<4?r>?}/? ?z ?C?8j<('!?"73??/???8?B?3>?8j<?/??*?Y?"73???8?8j<?*?pl?%?m?F-?Y?"73?8j<pl?%?? ?{? '?m?F-?8j<? ??!? ? ?{? '?8j<?!?ޛ ?$T?77 ?c? ? ?8j<ޛ ?$T???y?:?77 ?c?8j<???F ?|?F ?y?:?8j<?F ?>??,:??|?F ?8j<>????,:???8j<,:?????c??8j<|?F ?,:???c?p??8j<y?:?|?F ?p??l??8j<77 ?c?y?:?l??g?dr?8j< ? ?77 ?c?g?dr?}8? $?8j<{? '? ? ?}8? $?3 ?+?8j<m?F-?{? '?3 ?+?f ?3?8j<Y?"73?m?F-?f ?3?2?:?8j<??8?Y?"73?2?:??b@?8j<B?3>???8??b@?1?aG?8j<z ?C?B?3>?1?aG?P?M?8j<%?aG?z ?C?P?M?c?WS?8j<*+?$J?%?aG?c?WS?$?`X?8j<1?jM?*+?$J?$?`X?7x,?h\?8j<8?wjO?1?jM?7x,?h\?5?_?8j<@?O?8?wjO?5?_?@?`?8j<&G?wjO?@?O?@?`?tCJ?_?8j<N?jM?&G?wjO?tCJ?_?ˇS?h\?8j<\T?#J?N?jM?ˇS?h\?O[?`X?8j<LZ?aG?\T?#J?O[?`X?{a?WS?8j<6_?C?LZ?aG?{a?WS?f? M?8j<c?3>?6_?C?f? M?j?aG?8j<g?8?c?3>?j?aG?8n?`@?8j<Vk? 73?g?8?8n?`@?q?:?8j<n?F-?Vk? 73?q?:?s?3?8j<q? '?n?F-?s?3?u?+?8j<!=t? ?q? '?u?+?w? $?8j<v?c?!=t? ?w? $?Ly?ar?8j<2y?7?v?c?Ly?ar?J{??8j<{?F ?2y?7?J{??|??8j<}??{?F ?|??w~?c?8j<?>}??w~?c??8j<?>w~?c?7???8j<w~?c?|??rk~?I?7??8j<|??J{??s}??rk~?I?8j<J{??Ly?ar?|?:Z?s}??8j<Ly?ar?w? $?C{?Q*'?|?:Z?8j<w? $?u?+?z?K.?C{?Q*'?8j<u?+?s?3?y?6?z?K.?8j<s?3?q?:?a&x?r>?y?6?8j<q?:?8n?`@?}v?OF?a&x?r>?8j<8n?`@?j?aG?lt?hM?}v?OF?8j<j?aG?f? M?q?)U?lt?hM?8j<f? M?{a?WS?n?h\?q?)U?8j<{a?WS?O[?`X?h?Ic?n?h\?8j<O[?`X?ˇS?h\?/e`?ri?h?Ic?8j<ˇS?h\?tCJ?_?k S?q"n?/e`?ri?8j<tCJ?_?@?`?@?o?k S?q"n?8j<@?`?5?_?,?q"n?@?o?8j<5?_?7x,?h\?Ӛ?ri?,?q"n?8j<7x,?h\?$?`X?AI?Ic?Ӛ?ri?8j<$?`X?c?WS?'?h\?AI?Ic?8j<c?WS?P?M?CB?)U?'?h\?8j<P?M?1?aG? ?jM?CB?)U?8j<1?aG??b@?O ?PF? ?jM?8j<?b@?2?:??r>?O ?PF?8j<2?:?f ?3?w?!6??r>?8j<f ?3?3 ?+?H?M.?w?!6?8j<3 ?+?}8? $?;?T*'?H?M.?8j<}8? $?g?dr? I?=Z?;?T*'?8j<g?dr?l??h?? I?=Z?8j<l??p???M?h??8j<p???c?d???M?8j<?c???d???8j<d???????8j<?M?d??????8j<h???M?????8j< I?=Z?h??????8j<;?T*'? I?=Z????(?8j<H?M.?;?T*'??(??/?8j<w?!6?H?M.??/??7?8j<?r>?w?!6??7????8j<O ?PF??r>?????G?8j< ?jM?O ?PF??G??O?8j<CB?)U? ?jM??O??W?8j<'?h\?CB?)U??W??_?8j<AI?Ic?'?h\??_??h?8j<Ӛ?ri?AI?Ic??h??o?8j<,?q"n?Ӛ?ri??o??x?8j<@?o?,?q"n??x?G[d??8j<k S?q"n?@?o?G[d???x?8j</e`?ri?k S?q"n??x??o?8j<h?Ic?/e`?ri??o??g?8j<n?h\?h?Ic??g??_?8j<q?)U?n?h\??_??W?8j<lt?hM?q?)U??W??O?8j<}v?OF?lt?hM??O??G?8j<a&x?r>?}v?OF??G????8j<y?6?a&x?r>?????7?8j<z?K.?y?6??7??/?8j<C{?Q*'?z?K.??/??'?8j<|?:Z?C{?Q*'??'???8j<s}??|?:Z?????8j<rk~?I?s}??????8j<7??rk~?I?????8j<?>7?????8j< 3>?cH;??8j<??G;I?cH;?8j<??##<?G;I?8j<?ä0?BR<:Z?##<?8j<ä0?'?w?I<6?8j<??a'2G?$=NF?3?8j<a'2G?1O?e09=hM?$=NF?8j<1O?W?&$d=)U?e09=hM?8j<W?_?,y=h\?&$d=)U?8j<_?g?I=Ic?,y=h\?8j<g?p1o?=ri?I=Ic?8j<?o??x?y?q"n?i͏?ri?8j<?x?G[d???p?y?q"n?8j<G[d???x?5?q"n??p?8j<?x??o?[>ri?>q"n?8j<?o??h?~m>Ic?[>ri?8j<?h??_?!>h\?~m>Ic?8j<?_??W?z{>)U?!>h\?8j<?W??O?>jM?z{>)U?8j<?O??G?c>PF?>jM?8j<?G????L>r>?c>PF?8j<????7?+>!6?L>r>?8j<?7??/?o>M.?+>!6?8j<?/??(?>T*'?o>M.?8j<?(???m>=Z?>T*'?8j<????.>?m>=Z?8j<????>M?.>?8j<????7o>?>M?8j<????7o>??8j<7o>???>c??8j<>M?7o>?>c? >?8j<.>?>M? >?(>?8j<m>=Z?.>?(>?0>cr?8j<>T*'?m>=Z?0>cr?> $?8j<o>M.?>T*'?> $?ș>+?8j<+>!6?o>M.?ș>+?3>3?8j<L>r>?+>!6?3>3?7>:?8j<c>PF?L>r>?7>:?q>b@?8j<>jM?c>PF?q>b@?՝>aG?8j<z{>)U?>jM?՝>aG?(^>M?8j<!>h\?z{>)U?(^>M?8>WS?8j<~m>Ic?!>h\?8>WS?4>`X?8j<[>ri?~m>Ic?4>`X?>h\?8j<>q"n?[>ri?>h\?冔>_?8j<>p?>q"n?冔>_?>`?8j<O3>q"n?>p?>`?0V>_?8j<=ri?O3>q"n?0V>_?1>h\?8j<I=Ic?=ri?1>h\?>`X?8j<,y=h\?I=Ic?>`X?&=WS?8j<&$d=)U?,y=h\?&=WS?\=M?8j<e09=hM?&$d=)U?\=M?=aG?8j<$=NF?e09=hM?=aG?h8=`@?8j<3?$=NF?h8=`@?Cn=:?8j<I<6?3?Cn=:?L`F=3?8j<cH;?x;c??8j< 3>x;c?<??8j<x;c?F<??=8?8j<=aG?\=M?%>C?(=3>?8j<\=M?&=WS?і>aG?%>C?8j<&=WS?>`X?.>$J?і>aG?8j<>`X?1>h\?G>jM?.>$J?8j<1>h\?0V>_?gc>wjO?G>jM?8j<0V>_?>`?>P?gc>wjO?8j<>`?冔>_?*L>wjO?>P?8j<冔>_?>h\?3>kM?*L>wjO?8j<>h\?4>`X?>$J?3>kM?8j<4>`X?8>WS?4>aG?>$J?8j<8>WS?(^>M? m>C?4>aG?8j<(^>M?՝>aG?5z>3>? m>C?8j<՝>aG?q>b@?Ё>8?5z>3>?8j<q>b@?7>:?O>"73?Ё>8?8j<7>:?3>3? $>F-?O>"73?8j<3>3?ș>+?> '? $>F-?8j<ș>+?> $?@z> ?> '?8j<> $?0>cr?>c?@z> ?8j<0>cr?(>?e>:?>c?8j<(>? >?>F ?e>:?8j< >?>c?>?>F ?8j<>c???>??8j<>???U>??8j<>F ?>?U>?>F ?8j<e>:?>F ?>F ?1>?8j<>c?e>:?1>?E>$T?8j<@z> ?>c?E>$T?>!?8j<> '?@z> ?>!?`> ?8j< $>F-?> '?`> ?!'>%?8j<O>"73? $>F-?!'>%?>*?8j<Ё>8?O>"73?>*? >/?8j<5z>3>?Ё>8? >/?>"73?8j< m>C?5z>3>?>"73?>6?8j<4>aG? m>C?>6?-.>:?8j<>$J?4>aG?-.>:?> kM?>$J?> r>?8j<*L>wjO?3>kM?eX>r>?G>˛??8j<>P?*L>wjO?G>˛??>@?8j<gc>wjO?>P?>@?qi>˛??8j<G>jM?gc>wjO?qi>˛??2OS>r>?8j<.>$J?G>jM?2OS>r>?H=> aG?.>$J?H=> :?8j<%>C?і>aG?)>:?>6?8j<(=3>?%>C?>6?>!73?8j<=8?(=3>?>!73?a=/?8j<J= 73?=8?a=/?p=*?8j<o=F-?J= 73?p=*?tc=%?8j<g= '?o=F-?tc=%?tޏ= ?8j<-<= ?g= '?tޏ= ?ޑk= ?8j<Ys=c?-<= ?ޑk= ?ý9="T?8j<<7?Ys=c?ý9="T?c =?8j<<?O5<??8j< 3>O5<?U׹)? > '?8j<>6?)>:?4>+?">׹)?8j<)>:?H=> c-?4>+?8j<H=> r>?Y>M.?F>c-?8j<2OS>r>?qi>˛??l>/?Y>M.?8j<qi>˛??>@?>0?l>/?8j<>@?G>˛??>/?>0?8j<G>˛??eX>r>?t">N.?>/?8j<eX>r>?> b-?t">N.?8j<> :?}>+?>b-?8j<-.>:?>6?s>ع)?}>+?8j<>6?>"73?y)> '?s>ع)?8j<>"73? >/?w>,$?y)> '?8j< >/?>*?4z> ?w>,$?8j<>*?!'>%?4>Y?4z> ?8j<!'>%?`> ?O>?4>Y?8j<`> ?>!?>ŗ?O>?8j<>!?E>$T?>Du?>ŗ?8j<E>$T?1>?> 3 ?>Du?8j<1>?>F ?ͤ>x?> 3 ?8j<>F ?U>?vW>p?ͤ>x?8j<U>???vW>p??8j<vW>p???>??8j<ͤ>x?vW>p?>?0>?8j<> 3 ?ͤ>x?0>?>' ?8j<>Du?> 3 ?>' ?7> ?8j<>ŗ?>Du?7> ?J>?8j<O>?>ŗ?J>?>Cu?8j<4>Y?O>?>Cu?">?8j<4z> ?4>Y?">?8>%T?8j<w>,$?4z> ?8>%T?h/>x?8j<y)> '?w>,$?h/>x?>c?8j<s>ع)?y)> '?>c?r>r ?8j<}>+?s>ع)?r>r ?EX>dr?8j<>b-?}>+?EX>dr?ڙ>F?8j<t">N.?>b-?ڙ>F?G>=Z?8j<>/?t">N.?G>=Z?>i?8j<>0?>/?>i?> ?8j<l>/?>0?> ?n>i?8j<Y>M.?l>/?n>i?[p]>=Z?8j<F>c-?Y>M.?[p]>=Z?KL>F?8j<4>+?F>c-?KL>F?sO;>dr?8j<">׹)?4>+?sO;>dr?*>q ?8j< > '?">׹)?*>q ?#>c?8j<x>,$? > '?#>c?+ >x?8j<&= ?x>,$?+ >x?&=$T?8j<:-=Y?&= ?&=$T?@t=?8j<J=?:-=Y?@t=?D=Bu?8j<P=×?J=?D=Bu?͂=?8j<9X=Bu?P=×?͂=?Cn= ?8j<{!= 3 ?9X=Bu?Cn= ? 2=& ?8j<UVl<?{<??8j<Vl<?<?3<(?{<?8j<<? 2=& ?<=?3<(?8j< 2=& ?Cn= ?{=?<=?8j<Cn= ?͂=?b=,?{=?8j<͂=?D=Bu?=x?b=,?8j<D=Bu?@t=?=r ?=x?8j<@t=?&=$T?=F ?=r ?8j<&=$T?+ >x?Hr>U ?=F ?8j<+ >x?#>c?>F ?Hr>U ?8j<#>c?*>q ?.>!?>F ?8j<*>q ?sO;>dr?>>?.>!?8j<sO;>dr?KL>F?NO>zM?>>?8j<KL>F?[p]>=Z?c_>M?NO>zM?8j<[p]>=Z?n>i?Fo>?c_>M?8j<n>i?> ?>?Fo>?8j<> ?>i?'>?>?8j<>i?G>=Z?$N>M?'>?8j<G>=Z?ڙ>F?Wq>yM?$N>M?8j<ڙ>F?EX>dr?>?Wq>yM?8j<EX>dr?r>r ?,>!?>?8j<r>r ?>c?>F ?,>!?8j<>c?h/>x?Ƹ>U ?>F ?8j<h/>x?8>%T?\>F ?Ƹ>U ?8j<8>%T?">?>r ?\>F ?8j<">?>Cu?D>x?>r ?8j<>Cu?J>?[>,?D>x?8j<J>?7> ?>?[>,?8j<7> ?>' ?o>?>?8j<>' ?0>?L>(?o>?8j<0>?>?'>?L>(?8j<>???'>??8j<'>???>??8j<L>(?'>?>?>?8j<o>?L>(?>?>?8j<>?o>?>?>?8j<[>,?>?>?>?8j<D>x?[>,?>?>?8j<>r ?D>x?>?>?8j<\>F ?>r ?>?>?8j<Ƹ>U ?\>F ?>?>?8j<>F ?Ƹ>U ?>?>?8j<,>!?>F ?>?>?8j<>?,>!?>?>?8j<Wq>yM?>?>?>?8j<$N>M?Wq>yM?>?>?8j<'>?$N>M?>?>?8j<>?'>?>?>?8j<Fo>?>?>?o>?8j<c_>M?Fo>?o>?_>?8j<NO>zM?c_>M?_>?O>?8j<>>?NO>zM?O>??>?8j<.>!?>>??>?/>?8j<>F ?.>!?/>?>?8j<Hr>U ?>F ?>?>?8j<=F ?Hr>U ?>?=?8j<=r ?=F ?=?=?8j<=x?=r ?=?=?8j<b=,?=x?=?=?8j<{=?b=,?=?=?8j<<=?{=?=??=?8j<3<(?<=??=?<?8j<{<?3<(?<?v<?8j< 3>{<?v<??8j< 3>v<?{<(>?8j<v<?<?3<>{<(>8j<<??=?<=>3<>8j<?=?=?{=D><=>8j<=?=?b=>{=D>8j<=?=?=M>b=>8j<=?=?=>=M>8j<=?=?=r>=>8j<=?>?Hr>T>=r>8j<>?>?>@r>Hr>T>8j<>?/>?.>>>@r>8j</>??>?>>v>.>>8j<?>?O>?MO> e>>>v>8j<O>?_>?c_>f>MO> e>8j<_>?o>?Fo>'>c_>f>8j<o>?>?>>Fo>'>8j<>?>?'>'>>>8j<>?>?$N>g>'>'>8j<>?>?Wq> e>$N>g>8j<>?>?>v>Wq> e>8j<>?>?,>>>v>8j<>?>?>?r>,>>8j<>?>?Ƹ>T>>?r>8j<>?>?\>r>Ƹ>T>8j<>?>?>>\>r>8j<>?>?D>M>>>8j<>?>?[>>D>M>8j<>?>?>C>[>>8j<>?>?o>>>C>8j<>?>?L>>o>>8j<>?>?'>%>L>>8j<>???'>%>?8j<'>%>??>>?8j<L>>'>%>>>0>C>8j<o>>L>>0>C>>>8j<>C>o>>>>7> >8j<[>>>C>7> >J>0p>8j<D>M>[>>J>0p>>x>8j<>>D>M>>x>">>8j<\>r>>>">>8>W>8j<Ƹ>T>\>r>8>W>h/>>8j<>?r>Ƹ>T>h/>>>9>8j<,>>>?r>>9>r>>8j<>v>,>>r>>EX>6>8j<Wq> e>>v>EX>6>ڙ>s>8j<$N>g>Wq> e>ڙ>s>G>K>8j<'>'>$N>g>G>K>>.S>8j<>>'>'>>.S>>>8j<Fo>'>>>>>n>.S>8j<c_>f>Fo>'>n>.S>Zp]>K>8j<MO> e>c_>f>Zp]>K>KL>t>8j<>>v>MO> e>KL>t>rO;>8>8j<.>>>>v>rO;>8>*>>8j<>@r>.>>*>>!>9>8j<Hr>T>>@r>!>9>) >>8j<=r>Hr>T>) >>%=W>8j<=>=r>%=W>?t=>8j<=M>=>?t=>D={>8j<b=>=M>D={>̂=3p>8j<{=D>b=>̂=3p>Cn= >8j<<=>{=D>Cn= > 2=>8j<3<><=> 2=>8j<{<(>3<>Sl<>8j< 3>{<(>Sl<>?8j< 3>Sl<>U<>?8j<Sl<><M>U<>8j< 2=>y!=><M>8j< 2=>Cn= >9X=}>y!=>8j<Cn= >̂=3p>P={>9X=}>8j<̂=3p>D={>J=>P={>8j<D={>?t=>7-=oL>J=>8j<?t=>%=W>$=3>7-=oL>8j<%=W>) >>u>>$=3>8j<) >>!>9> > >u>>8j<!>9>*>>">T> > >8j<*>>rO;>8>4>(>">T>8j<rO;>8>KL>t>F>;>4>(>8j<KL>t>Zp]>K>Y>d>F>;>8j<Zp]>K>n>.S>l>>Y>d>8j<n>.S>>>>>l>>8j<>>>.S>>>>>8j<>.S>G>K>t">d>>>8j<G>K>ڙ>s>>;>t">d>8j<ڙ>s>EX>6>}>(>>;>8j<EX>6>r>>s>Q>}>(>8j<r>>>9>y)> >s>Q>8j<>9>h/>>w>>y)> >8j<h/>>8>W>4z>3>w>>8j<8>W>">>4>kL>4z>3>8j<">>>x>P>>4>kL>8j<>x>J>0p>>w>P>>8j<J>0p>7> >>x>>w>8j<7> >>>>>>x>8j<>>0>C>ͤ>M>>>8j<0>C>>>vW>>ͤ>M>8j<>>??vW>>?8j<vW>>??U>>?8j<ͤ>M>vW>>U>>>r>8j<>>ͤ>M>>r>1>N>8j<>x>>>1>N>E>W>8j<>w>>x>E>W>>>8j<P>>>w>>>a>3>8j<4>kL>P>>a>3>!'>/>8j<4z>3>4>kL>!'>/>>>8j<w>>4z>3>>> >v>8j<y)> >w>> >v>>>8j<s>Q>y)> >>>>B>8j<}>(>s>Q>>B>-.>>8j<>;>}>(>-.>>>߆>8j<t">d>>;>>߆>eX>'>8j<>>t">d>eX>'>G>mȀ>8j<>>>>G>mȀ>>>8j<l>>>>>>qi>mȀ>8j<Y>d>l>>qi>mȀ>0OS>'>8j<F>;>Y>d>0OS>'>G=>߆>8j<4>(>F>;>G=>߆>)>>8j<">T>4>(>)>>>B>8j< > >">T>>B>>>8j<u>> > >>>Z=y>8j<$=3>u>>Z=y>m=>8j<7-=oL>$=3>m=>qc=0>8j<J=>7-=oL>qc=0>qޏ=3>8j<P={>J=>qޏ=3>ّk=>8j<9X=}>P={>ّk=>9=W>8j<y!=>9X=}>9=W>a =N>8j<<M>y!=>a =N>/<$r>8j<U<><M>/<$r>O5< >8j< 3>U<>O5< >?8j< 3>O5< ><>?8j<O5< >/<$r><>8j</<$r>a =N>8j<a =N>9=W>Vs=9>8j<9=W>ّk=>-<=\>Vs=9>8j<ّk=>qޏ=3>g=%>-<=\>8j<qޏ=3>qc=0>o=Mr>g=%>8j<qc=0>m=>J=>o=Mr>8j<m=>Z=y>=;>J=>8j<Z=y>>> =">=;>8j<>>>B>%>s> =">8j<>B>)>>Ζ>xb>%>s>8j<)>>G=>߆>.>qT>Ζ>xb>8j<G=>߆>0OS>'>G>U.I>.>qT>8j<0OS>'>qi>mȀ>gc>#VB>G>U.I>8j<qi>mȀ>>>>?>gc>#VB>8j<>>G>mȀ>)L>#VB>>?>8j<G>mȀ>eX>'>3>U.I>)L>#VB>8j<eX>'>>߆>>qT>3>U.I>8j<>߆>-.>>4>xb>>qT>8j<-.>>>B> m>s>4>xb>8j<>B>>>5z> > m>s>8j<>> >v>с>;>5z> >8j< >v>>>P>>с>;>8j<>>!'>/>$>Er>P>>8j<!'>/>a>3>> >$>Er>8j<a>3>>>@z>\>> >8j<>>E>W>>9>@z>\>8j<E>W>1>N>e>E>>9>8j<1>N>>r>>?r>e>E>8j<>r>U>>>>>?r>8j<U>>??>>?8j<>>??>8>?8j<>?r>>>>8> >v>8j<e>E>>?r> >v>(> >8j<>9>e>E>(> >0>8>8j<@z>\>>9>0>8>>ꏶ>8j<> >@z>\>>ꏶ>ə>(>8j<$>Er>> >ə>(>3>M>8j<P>>$>Er>3>M>7>>8j<с>;>P>>7>>q>}|>8j<5z> >с>;>q>}|>՝>xb>8j< m>s>5z> >՝>xb>)^>˓I>8j<4>xb> m>s>)^>˓I>8>&2>8j<>qT>4>xb>8>&2>5>}>8j<3>U.I>>qT>5>}>>|\>8j<)L>#VB>3>U.I>>|\>䆔>μ>8j<>?>)L>#VB>䆔>μ>>=8j<gc>#VB>>?>>=.V>μ>8j<G>U.I>gc>#VB>.V>μ>1>|\>8j<.>qT>G>U.I>1>|\>>}>8j<Ζ>xb>.>qT>>}>=+2>8j<%>s>Ζ>xb>=+2>U=˓I>8j< =">%>s>U=˓I>=xb>8j<=;> =">=xb>^8=|>8j<J=>=;>^8=|> Cn= >8j<o=Mr>J=> Cn= >E`F=R>8j<g=%>o=Mr>E`F=R>1#= (>8j<-<=\>g=%>1#= (>=>8j<Vs=9>-<=\>=>h<@>8j<Vs=9>h<@>j<(>8j<j<(>F8j<<>Fx;8>8j< 3><>x;8>?8j< 3>x;8>cH;N>?8j<x;8>FG;p>cH;N>8j<Fj<(>#<>G;p>8j<j<(>h<@>|BR#<>8j<h<@>=>w<`>|BR8j<=>1#= (>w<`>8j<1#= (>E`F=R>=<ō>8j<E`F=R> Cn= >3<1>=<ō>8j< Cn= >^8=|>$=Άg>3<1>8j<^8=|>=xb>V09=e.I>$=Άg>8j<=xb>U=˓I>$d=Y+>V09=e.I>8j<U=˓I>=+2>%y=\>$d=Y+>8j<=+2>>}>I=۷=%y=\>8j<>}>1>|\>w=o=I=۷=8j<1>|\>.V>μ>K3>y=w=o=8j<.V>μ>>=>=K3>y=8j<>=䆔>μ>>y=>=8j<䆔>μ>>|\>[> o=>y=8j<>|\>5>}>m>Ƿ=[> o=8j<5>}>8>&2>!>|\>m>Ƿ=8j<8>&2>)^>˓I>{{>Y+>!>|\>8j<)^>˓I>՝>xb>>Z.I>{{>Y+>8j<՝>xb>q>}|>d>Ćg>>Z.I>8j<q>}|>7>>L>,>d>Ćg>8j<7>>3>M>+>>L>,>8j<3>M>ə>(>o>g>+>>8j<ə>(>>ꏶ>>Y>o>g>8j<>ꏶ>0>8>m>K>>Y>8j<0>8>(> >.>>m>K>8j<(> > >v>>g>.>>8j< >v>>8>7o>N>>g>8j<>8>??7o>N>?8j<7o>N>???>?8j<>g>7o>N>?>?>8j<.>>>g>?>?>8j<m>K>.>>?>?>8j<>Y>m>K>?>?>8j<o>g>>Y>?>?>8j<+>>o>g>?>?>8j<L>,>+>>?>?>8j<d>Ćg>L>,>?>? `>8j<>Z.I>d>Ćg>? `>?@>8j<{{>Y+>>Z.I>?@>? >8j<!>|\>{{>Y+>? >?>8j<m>Ƿ=!>|\>?>?=8j<[> o=m>Ƿ=?=?=8j<>y=[> o=?=>=8j<?=4?y=>=q?f 8j<y?y=?=q?f ?=8j<g͏?o=y?y=?=? =8j<?۷=g͏?o=? =?=8j<?\>?۷=?=? >8j<!!?Y+>?\>? >? >8j<Ʌ?e.I>!!?Y+>? >?@>8j<'?Άg>Ʌ?e.I>?@>?`>8j<?1>'?Άg>?`>? >8j<=<ō>3<1> >>8j<=<ō>> >8j<w<`> > >8j<|BRw<`> > >8j<#<>|BR >Y0 >8j<G;p>#<>Y0 > >8j<cH;N>G;p> > >8j< 3>cH;N> >?8j<?>? >7?N>?8j<? >? >rk~?p>7?N>8j<? >? >t}?>rk~?p>8j<? >? >|?K>t}?>8j<? >? >C{?`>|?K>8j<? >? >z?n>C{?`>8j<? >?>y?ō>z?n>8j<?>? >a&x?1>y?ō>8j<? >?`>}v?Άg>a&x?1>8j<?`>?@>lt?e.I>}v?Άg>8j<?@>? >q?Y+>lt?e.I>8j<? >? >n?\>q?Y+>8j<? >?=h?۷=n?\>8j<?=? =/e`?o=h?۷=8j<? =?=m S?y=/e`?o=8j<?=q?f @? =m S?y=8j<q?f >=,?y=@? =8j<>=?=Қ?o=,?y=8j<?=?=AI?Ƿ=Қ?o=8j<?=?>'?\>AI?Ƿ=8j<?>? >CB?Y+>'?\>8j<? >?@> ?Z.I>CB?Y+>8j<?@>? `>O ?Ɇg> ?Z.I>8j<? `>?>?*>O ?Ɇg>8j<?>?>w?>?*>8j<?>?>H?g>w?>8j<?>?>;?Y>H?g>8j<?>?> I?K>;?Y>8j<?>?>h?> I?K>8j<?>?>?g>h?>8j<?>?>d?N>?g>8j<?>??d?N>?8j<d?N>???8>?8j<?g>d?N>?8>p?v>8j<h?>?g>p?v>l? >8j< I?K>h?>l? >g?:>8j<;?Y> I?K>g?:>}8?폶>8j<H?g>;?Y>}8?폶>3 ?(>8j<w?>H?g>3 ?(>f ?M>8j<?*>w?>f ?M>2?>8j<O ?Ɇg>?*>2?> ?}|>8j< ?Z.I>O ?Ɇg> ?}|>1?xb>8j<CB?Y+> ?Z.I>1?xb>P?˓I>8j<'?\>CB?Y+>P?˓I>c?+2>8j<AI?Ƿ='?\>c?+2>$?}>8j<Қ?o=AI?Ƿ=$?}>7x,?|\>8j<,?y=Қ?o=7x,?|\>5?μ>8j<@? =,?y=5?μ>@?>8j<m S?y=@? =@?>uCJ?Ӽ>8j</e`?o=m S?y=uCJ?Ӽ>ˇS?\>8j<h?۷=/e`?o=ˇS?\>O[? }>8j<n?\>h?۷=O[? }>{a?02>8j<q?Y+>n?\>{a?02>f?ѓI>8j<lt?e.I>q?Y+>f?ѓI>j?xb>8j<}v?Άg>lt?e.I>j?xb>8n?|>8j<a&x?1>}v?Άg>8n?|>q? >8j<y?ō>a&x?1>q? >s?U>8j<z?n>y?ō>s?U>u? (>8j<C{?`>z?n>u? (>w?>8j<|?K>C{?`>w?>My?@>8j<t}?>|?K>My?@>J{?(>8j<rk~?p>t}?>J{?(>|?v>8j<7?N>rk~?p>|?v>w~?8>8j<?>7?N>w~?8>?8j<?>w~?8>}?>?8j<w~?8>|?v>{?Gr>}?>8j<|?v>J{?(>2y?E>{?Gr>8j<J{?(>My?@>v?9>2y?E>8j<My?@>w?>!=t?\>v?9>8j<w?>u? (>q?(>!=t?\>8j<u? (>s?U>n?Mr>q?(>8j<s?U>q? >Vk?đ>n?Mr>8j<q? >8n?|>g?;>Vk?đ>8j<8n?|>j?xb>c?%>g?;>8j<j?xb>f?ѓI>6_?s>c?%>8j<f?ѓI>{a?02>LZ?xb>6_?s>8j<{a?02>O[? }>\T?vT>LZ?xb>8j<O[? }>ˇS?\>N?Z.I>\T?vT>8j<ˇS?\>uCJ?Ӽ>&G?#VB>N?Z.I>8j<uCJ?Ӽ>@?>@?@>&G?#VB>8j<@?>5?μ>8?#VB>@?@>8j<5?μ>7x,?|\>1?U.I>8?#VB>8j<7x,?|\>$?}>*+?qT>1?U.I>8j<$?}>c?+2>%?xb>*+?qT>8j<c?+2>P?˓I>z ?s>%?xb>8j<P?˓I>1?xb>B?">z ?s>8j<1?xb> ?}|>??;>B?">8j< ?}|>2?>X?>??;>8j<2?>f ?M>m?Hr>X?>8j<f ?M>3 ?(>{?#>m?Hr>8j<3 ?(>}8?폶> ?\>{?#>8j<}8?폶>g?:>77 ?9> ?\>8j<g?:>l? >x?E>77 ?9>8j<l? >p?v>|??r>x?E>8j<p?v>?8>+:?>|??r>8j<?8>??+:?>?8j<+:?>??>?>?8j<|??r>+:?>>?>?r>8j<x?E>|??r>?r>?N>8j<77 ?9>x?E>?N>ݛ ?W>8j< ?\>77 ?9>ݛ ?W>?>8j<{?#> ?\>?>?3>8j<m?Hr>{?#>?3>ol?/>8j<X?>m?Hr>ol?/>?>8j<??;>X?>?> ?y>8j<B?">??;> ?y>''!?>8j<z ?s>B?">''!?>%?B>8j<%?xb>z ?s>%?B>h*?>8j<*+?qT>%?xb>h*?>}/?߆>8j<1?U.I>*+?qT>}/?߆>4?*>8j<8?#VB>1?U.I>4?*>w\:?mȀ>8j<@?@>8?#VB>w\:?mȀ>@?>8j<&G?#VB>@?@>@?>E?mȀ>8j<N?Z.I>&G?#VB>E?mȀ>4,K?,>8j<\T?vT>N?Z.I>4,K?,>P?߆>8j<LZ?xb>\T?vT>P?߆>U?>8j<6_?s>LZ?xb>U?>S_Z?B>8j<c?%>6_?s>S_Z?B>^?>8j<g?;>c?%>^?>c?{>8j<Vk?đ>g?;>c?{>Rf?>8j<n?Mr>Vk?đ>Rf?>j?0>8j<q?(>n?Mr>j?0>2n?3>8j<!=t?\>q?(>2n?3>Fq?>8j<v?9>!=t?\>Fq?>$dt?W>8j<2y?E>v?9>$dt?W>dw?N>8j<{?Gr>2y?E>dw?N>Nz?%r>8j<}?>{?Gr>Nz?%r>*}? >8j<?>}?>*}? >?8j<?>*}? >|?>?8j<*}? >Nz?%r>hRy?M>|?>8j<Nz?%r>dw?N>u?>hRy?M>8j<dw?N>$dt?W>o|r?~>u?>8j<$dt?W>Fq?>n?{>o|r?~>8j<Fq?>2n?3>Vk?>n?{>8j<2n?3>j?0>Yg?pL>Vk?>8j<j?0>Rf?>c?3>Yg?pL>8j<Rf?>c?{>_?>c?3>8j<c?{>^?>[?#>_?>8j<^?>S_Z?B>:GW?T>[?#>8j<S_Z?B>U?>R?(>:GW?T>8j<U?>P?߆>@N?=>R?(>8j<P?߆>4,K?,>;I?i>@N?=>8j<4,K?,>E?mȀ>D?>;I?i>8j<E?mȀ>@?>@?>D?>8j<@?>w\:?mȀ>42;?>@?>8j<w\:?mȀ>4?*>n6?d>42;?>8j<4?*>}/?߆>-1?;>n6?d>8j<}/?߆>h*?>A+-?(>-1?;>8j<h*?>%?B>Ƹ(?T>A+-?(>8j<%?B>''!?>Ck$? >Ƹ(?T>8j<''!?> ?y>D ?>Ck$? >8j< ?y>?>B?3>D ?>8j<?>ol?/>e?mL>B?3>8j<ol?/>?3>X?>e?mL>8j<?3>?> ?w>X?>8j<?>ݛ ?W> ?y> ?w>8j<ݛ ?W>?N>  ?> ?y>8j<?N>?r>?M>  ?>8j<?r>>?>ET?>?M>8j<>?>??ET?>?8j<ET?>???>?8j<?M>ET?>?>g?C>8j<  ?>?M>g?C>" ?>8j< ?y>  ?>" ?>2? >8j< ?w> ?y>2? >[?1p>8j<X?> ?w>[?1p>?y>8j<e?mL>X?>?y>n?>8j<B?3>e?mL>n?>c?W>8j<D ?>B?3>c?W>Kh"?>8j<Ck$? >D ?>Kh"?> }&?9>8j<Ƹ(?T>Ck$? > }&?9>G*?>8j<A+-?(>Ƹ(?T>G*?>.?:>8j<-1?;>A+-?(>.?:>3?t>8j<n6?d>-1?;>3?t>\7?K>8j<42;?>n6?d>\7?K>=;?.S>8j<@?>42;?>=;?.S>@?>8j<D?>@?>@?>SD?/S>8j<;I?i>D?>SD?/S>H?K>8j<@N?=>;I?i>H?K> L?v>8j<R?(>@N?=> L?v>$,Q?:>8j<:GW?T>R?(>$,Q?:>^U?>8j<[?#>:GW?T>^U?>Y?9>8j<_?>[?#>Y?9>]?>8j<c?3>_?>]?>|a?W>8j<Yg?pL>c?3>|a?W>ye?>8j<Vk?>Yg?pL>ye?>pwi?}>8j<n?{>Vk?>pwi?}>Om?3p>8j<o|r?~>n?{>Om?3p>q? >8j<u?>o|r?~>q? >t?>8j<hRy?M>u?>t?>\x?G>8j<|?>hRy?M>\x?G>M|?>8j<?>|?>M|?>?8j<?>M|?>|?(>?8j<M|?>\x?G>c&x?>|?(>8j<\x?G>t?>7t?>c&x?>8j<t?>q? >Gp?F>7t?>8j<q? >Om?3p>Sl?>Gp?F>8j<Om?3p>pwi?}>$]h?M>Sl?>8j<pwi?}>ye?>cd?>$]h?M>8j<ye?>|a?W>0e`?!r>cd?>8j<|a?W>]?>nc\?T>0e`?!r>8j<]?>Y?9>]X?Br>nc\?T>8j<Y?9>^U?>TT?>]X?Br>8j<^U?>$,Q?:> HP?v>TT?>8j<$,Q?:> L?v>8L?e> HP?v>8j< L?v>H?K>'H?j>8L?e>8j<H?K>SD?/S>D?'>'H?j>8j<SD?/S>@?>@?>D?'>8j<@?>=;?.S>;?'>@?>8j<=;?.S>\7?K>7?g>;?'>8j<\7?K>3?t>T3?e>7?g>8j<3?t>.?:>/?v>T3?e>8j<.?:>G*?>j+?>/?v>8j<G*?> }&?9>,'?@r>j+?>8j< }&?9>Kh"?>#?T>,'?@r>8j<Kh"?>c?W>њ?r>#?T>8j<c?W>n?>?>њ?r>8j<n?>?y>ޢ?M>?>8j<?y>[?1p>R?>ޢ?M>8j<[?1p>2? >?C>R?>8j<2? >" ?>< ?>?C>8j<" ?>g?C>?>< ?>8j<g?C>?>r?%>?>8j<?>??r?%>?8j<r?%>?????8j<?>r?%>????8j<< ?>?>?? ??8j<?C>< ?> ????8j<R?>?C>????8j<ޢ?M>R?>????8j<?>ޢ?M>????8j<њ?r>?>????8j<#?T>њ?r>??#??8j<,'?@r>#?T>#??'??8j<j+?>,'?@r>'??+??8j</?v>j+?>+??/??8j<T3?e>/?v>/??3??8j<7?g>T3?e>3??8??8j<;?'>7?g>8??;?'>@?>@??D??8j<'H?j>D?'>D??H??8j<8L?e>'H?j>H??L??8j< HP?v>8L?e>L??P??8j<TT?> HP?v>P??T??8j<]X?Br>TT?>T??X??8j<nc\?T>]X?Br>X??\??8j<0e`?!r>nc\?T>\??`??8j<cd?>0e`?!r>`??d??8j<$]h?M>cd?>d??h??8j<Sl?>$]h?M>h??l??8j<Gp?F>Sl?>l??p??8j<7t?>Gp?F>p??t??8j<c&x?>7t?>t??x??8j<|?(>c&x?>x??|??8j<?>|?(>|???8j<DATA@@M|;BRX)BRBrush? A=???L>?DNA1SDNANAMEq *next*prev*data*first*lastxyzwxminxmaxyminymax*pointergroupvalval2name[32]typesubtypeflagsaveddatalentotallen*newid*libname[24]usicon_id*propertiesid*idblock*filedataname[240]filename[240]totpad*parentw[2]h[2]changed[2]pad0pad1*rect[2]*obblocktypeadrcodename[128]*bp*beztmaxrcttotrctvartypetotvertipoextraprtbitmaskslide_minslide_maxcurval*drivercurvecurshowkeymuteipoposrelativetotelempad2*weightsvgroup[32]sliderminslidermax*refkeyelemstr[32]elemsizeblock*ipo*fromtotkeyslurph**scripts*flagactscripttotscript*line*formatblenlinenostartendflagscolor[4]pad[4]*namenlineslines*curl*sellcurcselcmarkers*undo_bufundo_posundo_len*compiledmtimesizeseekpassepartalphaangleclipstaclipendlensortho_scaledrawsizeshiftxshiftyYF_dofdistYF_apertureYF_bkhtypeYF_bkhbiasYF_bkhrotscriptlink*dof_obframenrframesoffsetsfrafie_imacyclokmulti_indexlayerpassmenunribufs*gputexture*anim*rrsourcelastframetpageflagtotbindxrepyreptwstatwendbindcode*repbind*packedfile*previewlastupdatelastusedanimspeedgen_xgen_ygen_typeaspxaspy*vnodetexcomaptomaptonegblendtype*object*texuvname[32]projxprojyprojzmappingofs[3]size[3]texflagcolormodelpmaptopmaptonegnormapspacewhich_outputpad[2]rgbkdef_varcolfacnorfacvarfacdispfacwarpfacname[160]*handle*pname*stnamesstypesvars*varstr*result*cfradata[32](*doit)()(*instance_init)()(*callback)()versionaipotype*ima*cube[6]imat[4][4]obimat[3][3]stypeviewscalenotlaycuberesdepthrecalclastsizenoisesizeturbulbrightcontrastrfacgfacbfacfiltersizemg_Hmg_lacunaritymg_octavesmg_offsetmg_gaindist_amountns_outscalevn_w1vn_w2vn_w3vn_w4vn_mexpvn_distmvn_coltypenoisedepthnoisetypenoisebasisnoisebasis2imaflagcropxmincropymincropxmaxcropymaxxrepeatyrepeatextendcheckerdistnablaiuser*nodetree*plugin*coba*envuse_nodespad[7]loc[3]rot[3]mat[4][4]min[3]max[3]pad3modetotexshdwrshdwgshdwbshdwpadenergydistspotsizespotblendhaintatt1att2*curfallofffalloff_typeshadspotsizebiassoftbufsizesampbuffersfiltertypebufflagbuftyperay_sampray_sampyray_sampzray_samp_typearea_shapearea_sizearea_sizeyarea_sizezadapt_threshray_samp_methodtexactshadhalostepsun_effect_typeskyblendtypehorizon_brightnessspreadsun_brightnesssun_sizebackscattered_lightsun_intensityatm_turbidityatm_inscattering_factoratm_extinction_factoratm_distance_factorskyblendfacsky_exposuresky_colorspacepad4YF_numphotonsYF_numsearchYF_phdepthYF_useqmcYF_bufsizeYF_padYF_causticblurYF_ltradiusYF_glowintYF_glowofsYF_glowtypeYF_pad2*mtex[18]specrspecgspecbmirrmirgmirbambrambbambgambemitangspectraray_mirroralpharefspeczoffsaddtranslucencyfresnel_mirfresnel_mir_ifresnel_trafresnel_tra_ifiltertx_limittx_falloffray_depthray_depth_traharseed1seed2gloss_mirgloss_trasamp_gloss_mirsamp_gloss_traadapt_thresh_miradapt_thresh_traaniso_gloss_mirdist_mirfadeto_mirshade_flagmode_lflarecstarclinecringchasizeflaresizesubsizeflarebooststrand_stastrand_endstrand_easestrand_surfnorstrand_minstrand_widthfadestrand_uvname[32]sbiaslbiasshad_alphaseptexrgbselpr_typepr_backpr_lampml_flagdiff_shaderspec_shaderroughnessrefracparam[4]rmsdarkness*ramp_col*ramp_specrampin_colrampin_specrampblend_colrampblend_specramp_showrampfac_colrampfac_spec*groupfrictionfhreflectfhdistxyfrictdynamodesss_radius[3]sss_col[3]sss_errorsss_scalesss_iorsss_colfacsss_texfacsss_frontsss_backsss_flagsss_presetYF_arYF_agYF_abYF_dscaleYF_dpwrYF_dsmpYF_presetYF_djitgpumaterialname[256]scale*bbi1j1k1i2j2k2selcol1selcol2quat[4]expxexpyexpzradrad2s*mat*imatelemsdisp**mattotcolwiresizerendersizethreshvec[3][3]alfaweightradiush1h2f1f2f3hidevec[4]mat_nrpntsupntsvresoluresolvorderuordervflaguflagv*knotsu*knotsvtilt_interpradius_interpcharidxkernhnurb*bevobj*taperobj*textoncurve*path*keybevpathlenbevresolwidthext1ext2resolu_renresolv_renspacemodespacinglinedistshearfsizewordspaceulposulheightxofyoflinewidth*strfamily[24]*vfont*vfontb*vfonti*vfontbisepchartotboxactbox*tbselstartselend*strinfocurinfoeffect*mface*mtface*tface*mvert*medge*dvert*mcol*msticky*texcomesh*mselectvdataedatafdatatotedgetotfacetotselectact_facecubemapsizesmoothreshsubdivsubdivrsubsurftype*mr*pv*tpageuv[4][2]col[4]transptileunwrapv1v2v3v4edcodecreasebweightdef_nr*dwtotweightco[3]no[3]pad[3]uv[2]co[2]indexfis[256]v[4]midv[2]*faces*colfaces*edges*edge_boundary_states*vert_edge_map*vert_face_map*map_mem*vertslevelslevel_countcurrentnewlvledgelvlpinlvlrenderlvluse_col*edge_flags*edge_creases*vert_map*edge_map*old_faces*old_edges*errormodifiersubdivTyperenderLevels*emCache*mCachedefaxispad[6]lengthrandomizeseed*ob_arm*start_cap*end_cap*curve_ob*offset_oboffset[3]scale[3]merge_distfit_typeoffset_typecountaxistolerance*mirror_obsplit_anglevalueresval_flagslim_flagse_flagsbevel_angledefgrp_name[32]*texturestrengthdirectionmidleveltexmapping*map_objectuvlayer_name[32]uvlayer_tmp*projectors[10]*imagenum_projectorsaspectxaspectypercentfaceCountfacrepeat*objectcenterstartxstartyheightnarrowspeeddampfallofftimeoffslifetimedeformflagmulti*prevCosparentinv[4][4]cent[3]*indexartotindexforce*clothObject*sim_parms*coll_parms*point_cache*x*xnew*xold*current_xnew*current_x*current_v*mfacesnumvertsnumfacesabsorptiontime*bvhtree*dmoperationvertextotinfluencegridsizeneedbind*bindweights*bindcostotcagevert*dyngrid*dyninfluences*dynverts*pad2dyngridsizedyncellmin[3]dyncellwidthbindmat[4][4]*psystotdmverttotdmedgetotdmfacepsysrt[2]*facepavgroupprotect*fss*target*auxTargetvgroup_name[32]keepDistshrinkTypeshrinkOptsprojAxissubsurfLevels*originfactorlimit[2]originOptspntswopntsuopntsvopntswtypeutypevtypewfufvfwdudvdw*defvec[8][3]partypepar1par2par3parsubstr[32]*track*proxy*proxy_group*proxy_from*action*poselib*poseconstraintChannelsdefbasemodifiersdloc[3]orig[3]dsize[3]drot[3]obmat[4][4]constinv[4][4]laycolbitstransflagipoflagtrackflagupflagnlaflagprotectflagipowinscaflagscavisflagboundtypedupondupoffdupstadupendsfctimemassdampinginertiaformfactorrdampingsizefacmarginmax_velmin_velm_contactProcessingThresholddtdtxactcolempty_drawtypepad1[3]empty_drawsizedupfacescapropsensorscontrollersactuatorsbbsize[3]actdefgameflaggameflag2*bsoftsoftflaganisotropicFriction[3]constraintsnlastripshooksparticlesystem*pd*soft*dup_groupfluidsimFlagrestrictflagshapenrshapeflagrecalcobody_type*fluidsimSettings*derivedDeform*derivedFinallastDataMaskstateinit_stategpulampcurindexactivedeflectforcefieldpdef_damppdef_rdamppdef_permpdef_frictpdef_rfrictf_strengthf_powerf_distf_dampmaxdistmindistmaxradminradf_power_rpdef_sbdamppdef_sbiftpdef_sboftclump_facclump_powkink_freqkink_shapekink_ampfree_endtex_nablatex_modekinkkink_axisrt2*rngf_noisesimframestartframeendframeeditframelinStiffangStiffvolumeviterationspiterationsditerationsciterationskSRHR_CLkSKHR_CLkSSHR_CLkSR_SPLT_CLkSK_SPLT_CLkSS_SPLT_CLkVCFkDPkDGkLFkPRkVCkDFkMTkCHRkKHRkSHRkAHRcollisionflagsnumclusteriterationswelding*particlestotpointtotspring*bpoint*bspringnodemassgravmediafrictrklimitphysics_speedgoalspringgoalfrictmingoalmaxgoaldefgoalvertgroupfuzzynessinspringinfrictefraintervallocalsolverflags**keystotpointkeysecondspringcolballballdampballstiffsbc_modeaeroedgeminloopsmaxloopschokesolver_IDplasticspringpreload*scratchshearstiffinpush*pointcacheshow_advancedoptionsresolutionxyzpreviewresxyzrealsizeguiDisplayModerenderDisplayModeviscosityValueviscosityModeviscosityExponentgravxgravygravzanimStartanimEndgstarmaxRefineiniVelxiniVelyiniVelz*orgMesh*meshSurface*meshBBsurfdataPath[240]bbStart[3]bbSize[3]typeFlagsdomainNovecgenvolumeInitTypepartSlipValuegenerateTracersgenerateParticlessurfaceSmoothingsurfaceSubdivsparticleInfSizeparticleInfAlphafarFieldSize*meshSurfNormalscpsTimeStartcpsTimeEndcpsQualityattractforceStrengthattractforceRadiusvelocityforceStrengthvelocityforceRadiuslastgoodframemistypehorrhorghorbhorkzenrzengzenbzenkambkfastcolexposureexprangelinfaclogfacgravityactivityBoxRadiusskytypeocclusionResphysicsEngineticratemaxlogicstepphysubstepmaxphystepmisimiststamistdistmisthistarrstargstarbstarkstarsizestarmindiststardiststarcolnoisedofstadofenddofmindofmaxaodistaodistfacaoenergyaobiasaomodeaosampaomixaocolorao_adapt_threshao_adapt_speed_facao_approx_errorao_approx_correctionao_samp_methodao_gather_methodao_approx_passes*aosphere*aotableshemiresmaxiterdrawtypesubshootpsubshootenodelimmaxsublamppamapamielmaelmimaxnodeconvergenceradfacgammaselcolsxsy*lpFormat*lpParmscbFormatcbParmsfccTypefccHandlerdwKeyFrameEverydwQualitydwBytesPerSeconddwFlagsdwInterleaveEveryavicodecname[128]*cdParms*padcdSizeqtcodecname[128]codecaudio_codecvideo_bitrateaudio_bitrategop_sizerc_min_raterc_max_raterc_buffer_sizemux_packet_sizemux_ratemixratemain*mat_override*light_overridelay_zmasklayflagpassflagpass_xor*avicodecdata*qtcodecdataffcodecdatacfrapsfrapefraimagesframaptothreadsframelenblurfacedgeRedgeGedgeBfullscreenxplayyplayfreqplayattribrt1stereomodedimensionspresetmaximsizexschyschxpartsypartswinposplanesimtypesubimtypequalityrpadrpad1rpad2scemoderendererocresalphamodeosafrs_secedgeintsafetyborderdisprectlayersactlayxaspyaspfrs_sec_basegausspostmulpostgammaposthuepostsatdither_intensitybake_osabake_filterbake_modebake_flagbake_normal_spacebake_quad_splitbake_maxdistbake_biasdistbake_padGIqualityGIcacheGImethodGIphotonsGIdirectYF_AAYFexportxmlYF_nobumpYF_clamprgbyfpad1GIdepthGIcausdepthGIpixelspersampleGIphotoncountGImixphotonsGIphotonradiusYF_raydepthYF_AApassesYF_AAsamplesyfpad2GIshadowqualityGIrefinementGIpowerGIindirpowerYF_gammaYF_exposureYF_raybiasYF_AApixelsizeYF_AAthresholdbackbuf[160]pic[160]stampstamp_font_idstamp_udata[160]fg_stamp[4]bg_stamp[4]simplify_subsurfsimplify_shadowsamplessimplify_particlessimplify_aossscineonwhitecineonblackcineongammajp2_presetjp2_depthrpad3domeresdomemodedomeangledometiltdomeresbuf*dometextparticle_percsubsurf_maxshadbufsample_maxao_errorcol[3]framename[64]*brushtoolseam_bleednormal_anglestepinverttotrekeytotaddkeybrushtypebrush[7]emitterdistdraw_timedname[36]mat[3][3]cornertypeeditbutflagjointrilimitdegrturnextr_offsdoublimitsegmentsringsverticesunwrapperuvcalc_radiusuvcalc_cubesizeuvcalc_marginuvcalc_mapdiruvcalc_mapalignuvcalc_flagautoik_chainlenimapaintparticleselect_threshclean_threshretopo_moderetopo_paint_toolline_divellipse_divretopo_hotspotmultires_subdiv_typeskgen_resolutionskgen_threshold_internalskgen_threshold_externalskgen_length_ratioskgen_length_limitskgen_angle_limitskgen_correlation_limitskgen_symmetry_limitskgen_retarget_angle_weightskgen_retarget_length_weightskgen_retarget_distance_weightskgen_optionsskgen_postproskgen_postpro_passesskgen_subdivisions[3]skgen_multi_level*skgen_templatebone_sketchingbone_sketching_convertskgen_subdivision_numberskgen_retarget_optionsskgen_retarget_rollskgen_side_string[8]skgen_num_string[8]edge_modepad3[2]dirview*session*cumapdrawbrushsmoothbrushpinchbrushinflatebrushgrabbrushlayerbrushflattenbrushpivot[3]brush_typetexnrtexrepttexfadetexsepaveragingtablet_sizetablet_strengthsymmrakeaxislock*camera*world*setbase*basactcursor[3]twcent[3]twmin[3]twmax[3]editbutsizeselectmodeproportionalprop_modeautomergepad5pad6autokey_mode*ed*radioframing*toolsettingsaudiotransform_spacesjumpframesnap_modesnap_flagsnap_target*theDagdagisvaliddagflagssculptdataframe_stepzoomblendximyimspacetypeblockscale*areablockhandler[8]viewmat[4][4]viewinv[4][4]persmat[4][4]persinv[4][4]winmat1[4][4]viewmat1[4][4]viewquat[4]zfaclay_usedpersp*ob_centre*bgpic*localvd*ri*retopo_view_data*depthsob_centre_bone[32]localviewlayactscenelockaroundcamzoompivot_lastgridgridviewpixsizenearfarcamdxcamdygridlinesviewbutgridflagmodeselecttwtypetwmodetwflagtwdrawflagtwmat[4][4]clip[4][4]*clipbbafterdrawzbufxrayflag2gridsubdivkeyflagsndofmodendoffilter*properties_storage*gpdlviewquat[4]lpersplviewverthormaskmin[2]max[2]minzoommaxzoomscrollkeeptotkeepaspectkeepzoomoldwinxoldwinycursor[2]rowbutv2d*editipoipokeyactname[32]constname[32]bonename[32]totipopinbutofschannellockmedian[3]cursenscuractaligntabomainbmainbo*lockpointexfromshowgroupmodeltypescriptblockre_alignoldkeypresstab[7]render_sizechanshownzebra*filelisttotfiletitle[24]dir[240]file[80]ofssortmaxnamelencollumsf_fpfp_str[8]*libfiledataretvalmenuact(*returnfunc)()(*returnfunc_event)()(*returnfunc_args)()*arg1*arg2*menup*pupmenuoopsvisiflagtree*treestoresearch_string[32]search_tsesearch_flagsdo_outlinevisstoreflagdeps_flagsimanrcurtileimtypenrdt_uvstickydt_uvstretchpad[5]centxcentyautosnap*texttopviewlinesfont_idlheightleftshowlinenrstabnumbercurrtab_setshowsyntaxoverwritepix_per_linetxtscrolltxtbarwordwrapdoplugins*py_draw*py_event*py_button*py_browsercallback*py_globaldictlastspacescriptname[256]scriptarg[256]*script*but_refsredraws*idaspect*curfont*edittreetreetype*filesactive_filenumtilesxnumtilesyselstateviewrectbookmarkrectscrollposscrollheightscrollareaactive_bookmarkprv_wprv_h*imgoutline[4]neutral[4]action[4]setting[4]setting1[4]setting2[4]num[4]textfield[4]textfield_hi[4]popup[4]text[4]text_hi[4]menu_back[4]menu_item[4]menu_hilite[4]menu_text[4]menu_text_hi[4]but_drawtypeiconfile[80]back[4]header[4]panel[4]shade1[4]shade2[4]hilite[4]grid[4]wire[4]select[4]lamp[4]active[4]group[4]group_active[4]transform[4]vertex[4]vertex_select[4]edge[4]edge_select[4]edge_seam[4]edge_sharp[4]edge_facesel[4]face[4]face_select[4]face_dot[4]normal[4]bone_solid[4]bone_pose[4]strip[4]strip_select[4]cframe[4]vertex_sizefacedot_sizebpad[2]syntaxl[4]syntaxn[4]syntaxb[4]syntaxv[4]syntaxc[4]movie[4]image[4]scene[4]audio[4]effect[4]plugin[4]transition[4]meta[4]editmesh_active[4]handle_vertex[4]handle_vertex_select[4]handle_vertex_sizehpad[7]solid[4]tuitbutstv3dtfiletipotinfotsndtacttnlatseqtimatimaseltexttoopsttimetnodetarm[20]bpad[4]bpad1[4]spec[4]dupflagsavetimetempdir[160]fontdir[160]renderdir[160]textudir[160]plugtexdir[160]plugseqdir[160]pythondir[160]sounddir[160]yfexportdir[160]versionsvrmlflaggameflagswheellinescrolluiflaglanguageuserprefviewzoomconsole_bufferconsole_outmixbufsizefontsizeencodingtransoptsmenuthreshold1menuthreshold2fontname[256]themesundostepsundomemorygp_manhattendistgp_euclideandistgp_erasergp_settingstb_leftmousetb_rightmouselight[3]tw_hotspottw_flagtw_handlesizetw_sizetextimeouttexcollectratememcachelimitprefetchframesframeserverportpad_rot_angleobcenter_diarvisizervibrightrecent_filessmooth_viewtxglreslimitndof_panndof_rotatecurssizepad[8]versemaster[160]verseuser[160]glalphaclipautokey_flagcoba_weightvertbaseedgebaseareabase*sceneendxendysizexsizeyscenenrscreennrfullmainwinwinakthandler[8]*newvvec*v1*v2panelname[64]tabname[64]drawname[64]ofsxofsycontrolsnapold_ofsxold_ofsysortcounter*paneltab*v3*v4*fullwinmat[4][4]headrctwinrctheadwinwinheadertypebutspacetypewinxwinyhead_swaphead_equalwin_swapwin_equalheadbutlenheadbutofscursorspacedatauiblockspanelssubvstr[4]subversionpadsminversionminsubversiondisplaymode*curscreen*curscenefileflagsglobalfname[80]*ibuf*ibuf_comp*se1*se2*se3nrbottomrightxofsyofslift[3]gamma[3]gain[3]saturation*guidir[160]donestartstillendstill*stripdataorxory*crop*transform*color_balance*tstripdata*tstripdata_startstill*tstripdata_endstill*ibuf_startstill*ibuf_endstill*instance_private_data**current_private_data*tmpstartofsendofsmachinestartdispenddispmulhandsizeanim_preseek*stripfacf0facf1*seq1*seq2*seq3seqbase*sound*hdaudiolevelpanstrobe*effectdataanim_startofsanim_endofsblend_modeblend_opacity*oldbasep*parseq*seqbasepmetastackedgeWidthforwardwipetypefMinifClampfBoostdDistdQualitybNoCompScalexIniScaleyIniScalexFinScaleyFinxInixFinyIniyFinrotInirotFininterpolation*frameMapglobalSpeedlastValidFramebuttypeuserjitstatotpartnormfacobfacrandfactexfacrandlifeforce[3]vectsizemaxlendefvec[3]mult[4]life[4]child[4]mat[4]texmapcurmultstaticstepomattimetexspeedtexflag2negvertgroup_vvgroupname[32]vgroupname_v[32]*keysminfacusedusedelemdxdylinkotypeold*poin*oldpoinresetdistlastval*makeyqualqual2targetName[32]toggleName[32]value[32]maxvalue[32]delaydurationmaterialName[32]damptimerpropname[32]matname[32]axisflag*fromObjectsubject[32]body[32]pulsefreqtotlinks**linkstapjoyindexaxis_singleaxisfbuttonhathatfprecisionstr[128]module[64]*mynewinputstotslinks**slinksvalostate_mask*actframeProp[32]blendinpriorityend_resetstrideaxisstridelengthsndnrpad1[2]makecopycopymadepad2[1]track*melinVelocity[3]angVelocity[3]localflagdyn_operationforceloc[3]forcerot[3]linearvelocity[3]angularvelocity[3]*referencebutstabutendminmaxvisifacrotdampminloc[3]maxloc[3]minrot[3]maxrot[3]matprop[32]distributionint_arg_1int_arg_2float_arg_1float_arg_2toPropName[32]*toObjectbodyTypefilename[64]loadaniname[64]int_argfloat_arggoaccellerationmaxspeedmaxrotspeedmaxtiltspeedtiltdampspeeddamp*sample*stream*newpackedfile*snd_soundpanningattenuationpitchmin_gainmax_gaindistancestreamlenchannelshighpriopad[10]gaindopplerfactordopplervelocitynumsoundsblendernumsoundsgameengine*lamprengobjectdupli_ofs[3]childbaserollhead[3]tail[3]bone_mat[3][3]arm_head[3]arm_tail[3]arm_mat[4][4]xwidthzwidthease1ease2rad_headrad_tailbonebasechainbasepathflaglayer_protectedghostepghostsizeghosttypepathsizeghostsfghostefpathsfpathefpathbcpathacconstflagikflagselectflagagrp_index*bone*childiktree*b_bone_mats*dual_quat*b_bone_dual_quatschan_mat[4][4]pose_mat[4][4]pose_head[3]pose_tail[3]limitmin[3]limitmax[3]stiffness[3]ikstretch*customchanbaseproxy_layerstride_offset[3]cyclic_offset[3]agroupsactive_groupcustomColcs*grpreserved1groupsactive_markeractnractwidthtimeslidename[30]ownspacetarspaceenforceheadtail*tarsubtarget[32]matrix[4][4]space*proptarnumtargetsiterationsrootbonemax_rootbone*poletarpolesubtarget[32]poleangleorientweightgrabtarget[3]reserved2minmaxflagstuckcache[3]lockflagfollowflagvolmodeplaneorglengthbulgepivXpivYpivZaxXaxYaxZminLimit[6]maxLimit[6]extraFzinvmat[4][4]fromtomap[3]expofrom_min[3]from_max[3]to_min[3]to_max[3]zminzmaxpad[9]channel[32]no_rot_axisstride_axiscurmodactstartactendactoffsstridelenblendoutstridechannel[32]offs_bone[32]hasinputhasoutputdatatypesockettype*new_socknslimitstack_indexinternstack_index_extlocxlocyown_indexto_index*tosock*link*new_nodeusername[32]lastyoutputs*storageminiwidthcustom1custom2custom3custom4need_execexectotrbutrprvr*typeinfo*fromnode*tonode*fromsocknodeslinks*stack*threadstackinitstacksizecur_indexalltypes*owntype*selin*selout(*timecursor)()(*stats_draw)()(*test_break)()cyclicmoviesamplesminspeedpercentxpercentybokehcurvedimage_in_widthimage_in_heightcenter_xcenter_yspiniterwrapsigma_colorsigma_spacehuesatt1t2t3fstrengthfalphakey[4]x1x2y1y2colname[32]bktyperotationpreviewgamcono_zbuffstopmaxblurbthresh*dict*nodeangle_ofscolmodmixthresholdfademcjitprojfitshortymintablemaxtableext_in[2]ext_out[2]*curve*table*premultablecurrcliprcm[4]black[3]white[3]bwmul[3]sample[3]offset[2]innerradiusratergb[3]cloneactive_rndactive_cloneactive_mask*layerstotlayermaxlayertotsize*pooleditflagvel[3]rot[4]ave[3]numparentpa[4]w[4]fuv[4]foffsetrand[3]*stick_obprev_state*hairi_rot[4]r_rot[4]r_ave[3]r_ve[3]dietimebanksizemulnum_dmcachebpialiveloopdistrphystyperotmodeavemodereacteventdrawdraw_asdraw_sizechildtypedraw_stepren_stephair_stepkeys_stepadapt_angleadapt_pixrotfromintegratornbetweenboidneighboursbb_alignbb_uv_splitbb_animbb_split_offsetbb_tiltbb_rand_tiltbb_offset[2]simplify_flagsimplify_refsizesimplify_ratesimplify_transitionsimplify_viewporttimetweakjitfackeyed_timeeff_hairgrid_respartfactanfactanphasereactfacavefacphasefacrandrotfacrandphasefacrandsizereactshapeacc[3]dragfacbrownfacdampfacabslengthrandlengthchild_nbrren_child_nbrparentschildsizechildrandsizechildradchildflatchildspreadclumpfacclumppowrough1rough1_sizerough2rough2_sizerough2_thresrough_endrough_end_shapebranch_thresdraw_line[2]max_lat_accmax_tan_accaverage_velbankingmax_bankgroundzboidfac[8]boidrule[8]*eff_group*dup_ob*bb_ob*pd2*part*edit**pathcache**childcachepathcachebufschildcachebufs*target_ob*keyed_ob*latticeeffectorsreacteventstotchildtotcachedtotchildcachetarget_psyskeyed_psystotkeyedbakespacebb_uvname[3][32]vgroup[12]vg_negrt3*renderdata*cacheCdisCvi[3]structuralbendingmax_bendmax_structmax_shearavg_spring_lentimescaleeff_force_scaleeff_wind_scalesim_time_oldstepsPerFrameprerollmaxspringlensolver_typevgroup_bendvgroup_massvgroup_structpresets*collision_listepsilonself_frictionselfepsilonself_loop_countloop_countpressure*pointstotpointsthicknessstrokesframenum*actframegstepinfo[128]sbuffer_sizesbuffer_sflag*sbufferTYPEdcharucharshortushortintlongulongfloatdoublevoidLinkLinkDataListBasevec2svec2ivec2fvec2dvec3ivec3fvec3dvec4ivec4fvec4drctirctfIDPropertyDataIDPropertyIDLibraryFileDataPreviewImageIpoDriverObjectIpoCurveBPointBezTripleIpoKeyBlockKeyScriptLinkTextLineTextMarkerTextPackedFileCameraImageUserImageGPUTextureanimRenderResultMTexTexPluginTexCBDataColorBandEnvMapImBufbNodeTreeTexMappingLampCurveMappingWaveMaterialGroupVFontVFontDataMetaElemBoundBoxMetaBallNurbCharInfoTextBoxCurvePathMeshMFaceMTFaceTFaceMVertMEdgeMDeformVertMColMStickyMSelectCustomDataMultiresPartialVisibilityMDeformWeightMTexPolyMLoopUVMLoopColMFloatPropertyMIntPropertyMStringPropertyOrigSpaceFaceMultiresColMultiresColFaceMultiresFaceMultiresEdgeMultiresLevelMultiresMapNodeModifierDataSubsurfModifierDataLatticeModifierDataCurveModifierDataBuildModifierDataMaskModifierDataArrayModifierDataMirrorModifierDataEdgeSplitModifierDataBevelModifierDataBMeshModifierDataDisplaceModifierDataUVProjectModifierDataDecimateModifierDataSmoothModifierDataCastModifierDataWaveModifierDataArmatureModifierDataHookModifierDataSoftbodyModifierDataClothModifierDataClothClothSimSettingsClothCollSettingsPointCacheCollisionModifierDataBVHTreeSurfaceModifierDataDerivedMeshBVHTreeFromMeshBooleanModifierDataMDefInfluenceMDefCellMeshDeformModifierDataParticleSystemModifierDataParticleSystemParticleInstanceModifierDataExplodeModifierDataFluidsimModifierDataFluidsimSettingsShrinkwrapModifierDataSimpleDeformModifierDataLatticebDeformGroupbActionbPoseBulletSoftBodyPartDeflectSoftBodyObHookRNGSBVertexBodyPointBodySpringSBScratchWorldRadioBaseAviCodecDataQuicktimeCodecDataFFMpegCodecDataAudioDataSceneRenderLayerRenderDataRenderProfileGameFramingTimeMarkerImagePaintSettingsBrushParticleBrushDataParticleEditSettingsTransformOrientationToolSettingsBrushDataSculptDataSculptSessionSceneDagForestBGpicView3DSpaceLinkScrAreaRenderInfoRetopoViewDataViewDepthsbGPdataView2DSpaceInfoSpaceIpoSpaceButsSpaceSeqSpaceFiledirentryBlendHandleSpaceOopsTreeStoreTreeStoreElemSpaceImageSpaceNlaSpaceTextScriptSpaceScriptSpaceTimeSpaceNodeSpaceImaSelFileListThemeUIThemeSpaceThemeWireColorbThemeSolidLightUserDefbScreenScrVertScrEdgePanelFileGlobalStripElemTStripElemStripCropStripTransformStripColorBalanceStripColorBalanceGUIHelperStripProxyStripPluginSeqSequencebSoundhdaudioMetaStackEditingWipeVarsGlowVarsTransformVarsSolidColorVarsSpeedControlVarsEffectBuildEffPartEffParticleWaveEffOopsbPropertybNearSensorbMouseSensorbTouchSensorbKeyboardSensorbPropertySensorbActuatorSensorbDelaySensorbCollisionSensorbRadarSensorbRandomSensorbRaySensorbMessageSensorbSensorbControllerbJoystickSensorbExpressionContbPythonContbActuatorbAddObjectActuatorbActionActuatorbSoundActuatorbCDActuatorbEditObjectActuatorbSceneActuatorbPropertyActuatorbObjectActuatorbIpoActuatorbCameraActuatorbConstraintActuatorbGroupActuatorbRandomActuatorbMessageActuatorbGameActuatorbVisibilityActuatorbTwoDFilterActuatorbParentActuatorbStateActuatorFreeCamerabSamplebSoundListenerSpaceSoundGroupObjectBonebArmaturebPoseChannelbActionGroupbActionChannelSpaceActionbConstraintChannelbConstraintbConstraintTargetbPythonConstraintbKinematicConstraintbTrackToConstraintbRotateLikeConstraintbLocateLikeConstraintbMinMaxConstraintbSizeLikeConstraintbActionConstraintbLockTrackConstraintbFollowPathConstraintbStretchToConstraintbRigidBodyJointConstraintbClampToConstraintbChildOfConstraintbTransformConstraintbLocLimitConstraintbRotLimitConstraintbSizeLimitConstraintbDistLimitConstraintbShrinkwrapConstraintbActionModifierbActionStripbNodeStackbNodeSocketbNodeLinkbNodebNodePreviewbNodeTypeNodeImageAnimNodeBlurDataNodeDBlurDataNodeBilateralBlurDataNodeHueSatNodeImageFileNodeChromaNodeTwoXYsNodeTwoFloatsNodeGeometryNodeVertexColNodeDefocusNodeScriptDictNodeGlareNodeTonemapNodeLensDistTexNodeOutputCurveMapPointCurveMapBrushCloneCustomDataLayerHairKeyParticleKeyChildParticleParticleDataParticleSettingsParticleEditParticleCacheKeyLinkNodebGPDspointbGPDstrokebGPDframebGPDlayerTLEN   L4( P\$8Tpx(x T|8lLDlh88,< L   @ 84DX`D`t@<l<<\hd4Dd<@L@@@<lht(T8xl(4H8P HP|<$$X P$88 x P< 088,@0,Hh(H,(lDLP<L< \PLlT`<8l (DtH@,@t<h4,,D,@,4` l\4<$x( (@   ,D8HSTRC9                     !"#$%&'()*+, -./0!!!"1#234./56789  :;<=>$ ?@.AB%%%%C=/DEF GHIJ& %KLM= N$OPQR'STUV%(((WXY) ))Z[\+]^_*`]a b(c(def ghij kl+mn]% ,opqrstuvwxyz{|$O'} ~- . " /01%++ 2 394   %5C@6$@57 .8qr38-9$O.467:    -;P  <Fqr !"#$%&'()*+,-.+/0123456789:;<=>?@ABCDEFGHIJKL2M$O'}=$O>NOPQRSTUVWXYZ[\]^_`abcdefghijklmnopqrstuvw xyz{|}~/@66 2M9$O?F'} @%A+BBBCDC  $O># "%EEE"1#2F%FGH9C     $OI&> FbC    @ @@@%GFFJ'C $O&>KLMNOPQ R!J"S#T$T%T&6'()*+%,-./U0V1 M 2345 67K89:;%<O89=>W?PW@ANBC>DQX.25 67YEZ%RFSGL3.25 67[H\I]J^3_`_4aKLbMLcccaN`ObPQ R SdT6('%NUU VNUWXYZ[\]T$T&^_V`aKbOc('6%eee dfeefVg] h igee hee jkiee[lmnjee oH k ee p q r stulvwx]yleez{ |mee}]n ee~%]oee%p ee3 %q ee .]%reeseetee muee 3 %+veeF w ee xeeyeez{|}~eeNNNNNNK%eeee %ee %6ee9ee -eeee} ee  k ee  z%F%"$O&PC% o &    $OIC      >      !"#$%'} & ' ( )*G+4,-./0 1 2 3 456?789:;,<=>?@ABCF D & EF$GHIJKLMNOPQRSTUVWXYZ[\]^_`abcd3efn}ghijklmnopqrstuvwxyz{|}~,%Q}0JJJ$ONG/TVU      +$O2M'} !"#$%&'( ) *+,-./0123%4 5 67F8 9:;<=]>?@ABCDD >E?FGH%IJKLMNOPQRSTUVWXYZ[\]^d_`"mabcdefghi#jklmn opqrstuvw xy%z{|}~ F* +F+F m8%   m   2M</] !+ "#$. %&'()*+,-./0129 34567'} g 89:;<=>?@@A% .- mBCDEKFGHIJKLMNOPQRS  " TUVWXYZ[\]^_`+sabcdefg'hijklmnopqCr st5uvwxyz {|}~01$@^kFGHIFGHIFGHIF  $OPA.$FGHWI  %/FGHI B|!FGHI+F     FGHI 9  FGHI.-< ,B | FGHIFGHI*]      ] FGH]+ FGHFGHIP  99%|*FGHI f%+     8     D6 !"#$%&'()*+,-./012345_6789:;<=>?@ABCDEFGHIJK "%LMNOPQRSTUVWXYZ[\]^%4_B`abcdefghijklmnopqrstuvwxyz{ |}~%26   % v%F4F'}    f  88  %0mj%988      +  [$O0          %9p !"# $%&'()*+,-.%/0]l12929-234\5Qn6789:;<=%>?@ABCDEFGHvIJKLM?2NOEP QR S TU% V WXY%+F>Z%[\]^_%`a%bc%de Fpznbfg +h ijkTlmn+F o -p% qzrstuvwx*y z{nT|F  o}~% - 4\ 4\  4\m   -J % " ` -  T  4\+@ -z  % 4\D@?nf j+Fk4\_* - zT  - % ++ $Om]FGH   F - %? & l   "   1  &        %!!! """!$O    g%#FGHI $$$$O % %%      %$O& && %'*  (  ) ]%* + , +F - . [\%/ !0 "1 #$%&2  '()*+,-./%+F3 v4 %05 123456786    9:v7    9:v8    9:v9  %: ;; ;;<= -<<< >?$O [\@ABCDEF = GHIJ>>>>K=LMNOP+QRST>U?V@ @@@WXYN { Z [QR\]^_`abcdeABf???@g@h>i>U9 j k=l mnop qBr>s>t u vwCxy%Dz{D|}"~%%E pB%F%GHhij9IJKLMN zO  P jpmQ[%HR%STU TTT< @UV.\% Cm\/%2MVW F_ TW% XB%YBZ[ YBYXYMm%Qd\p1F.bc4\:  953 678        m      l            ^\]    ! " # $ % & ' ( ) * + , - ?7?. / 0 $O51 %\2 [Z]3 ^4 ^5 6 7 6 8 9 : ; < Nn5= > ? 9@ A B /C D E F G H }{"_I J K L M N O P Q R S T U V W ]X Y Z [ \ ] ^ %F|__ ` a b ]c d `e aaa`f g h bbb i j c cc bk h l ^m  xn o p ENDB